(data stored in ACNUC9435 zone)

EMBL: CP000904.PE105

CP000904.PE105       Location/Qualifiers
FT   CDS             complement(152103..153143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_1599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5548"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46529"
FT                   /db_xref="GOA:A9VV97"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV97"
FT                   /protein_id="ABY46529.1"
FT                   /translation="MYIKRIKKFTIEDGVLSAYVIIFTLMISLTTTYLIKINGIDKITN
FT                   NFYSKNSVAFHIKDDNRPLNMQNLLDHIDERDFMLFKENVLELPYIKGIYKSGDIATPP
FT                   LVSGRFFQADDFFRNKNIAVVGKDNNDIVLKNDKKYIQLNNTSFEIIGVMGEDFSTKLD
FT                   KMIYLNLDAALKLENESYGSYVLDGNKVMTSTFDRLEQDMRSSISIVKADKETVGSSRV
FT                   FERNRGDYGIFVLFILVILSMSIIICSYWFYKKRISISIQHVIGHRMFNIYMNLFKKHV
FT                   LLLISSYFFSIFMFIIFNLNNIDAHLEKYMYSCGLGILFLCVYHFILCILAMFIYSSKI
FT                   RLKVLK"
     MYIKRIKKFT IEDGVLSAYV IIFTLMISLT TTYLIKINGI DKITNNFYSK NSVAFHIKDD        60
     NRPLNMQNLL DHIDERDFML FKENVLELPY IKGIYKSGDI ATPPLVSGRF FQADDFFRNK       120
     NIAVVGKDNN DIVLKNDKKY IQLNNTSFEI IGVMGEDFST KLDKMIYLNL DAALKLENES       180
     YGSYVLDGNK VMTSTFDRLE QDMRSSISIV KADKETVGSS RVFERNRGDY GIFVLFILVI       240
     LSMSIIICSY WFYKKRISIS IQHVIGHRMF NIYMNLFKKH VLLLISSYFF SIFMFIIFNL       300
     NNIDAHLEKY MYSCGLGILF LCVYHFILCI LAMFIYSSKI RLKVLK                      346
//

If you have problems or comments...

PBIL Back to PBIL home page