(data stored in ACNUC9435 zone)

EMBL: CP000904.PE106

CP000904.PE106       Location/Qualifiers
FT   CDS             complement(153345..153782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_1598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5549"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46530"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV98"
FT                   /protein_id="ABY46530.1"
FT                   /translation="MLRRKTIALGLAGAMILPTGSVFADENTGSKINSQSIEQTEPQNF
FT                   TEYLGWSELESDKEQIQFSNLNYATQGVSHAGWAEYKNDKRRAVGETTWNGVYHYTRAQ
FT                   LKLYWSVKADSGRQWDWHETRAESPWKNEFFSAHTFYGNEK"
     MLRRKTIALG LAGAMILPTG SVFADENTGS KINSQSIEQT EPQNFTEYLG WSELESDKEQ        60
     IQFSNLNYAT QGVSHAGWAE YKNDKRRAVG ETTWNGVYHY TRAQLKLYWS VKADSGRQWD       120
     WHETRAESPW KNEFFSAHTF YGNEK                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page