(data stored in ACNUC9435 zone)

EMBL: CP000904.PE107

CP000904.PE107       Location/Qualifiers
FT   CDS             complement(154580..155275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5550"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: gfo:GFO_0338 gliding motility protein GldA"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5550"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46531"
FT                   /db_xref="GOA:A9VUG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG0"
FT                   /protein_id="ABY46531.1"
FT                   /translation="MTVLNIKEVCKRYKKKIALSPISFQSKQGECIVLCGGNGAGKSTL
FT                   LDIIAGITTPTTGTVQLGNIELQKDRKQYVSEIGYMPDDFHAQQDMTVQEFLFFYAAFR
FT                   NIGKEKVQAVIKSIGLNEKKNERLHRLSKGMRQRLLFGQAYLGNPKILILDEPTNGLDP
FT                   YWVDEFLTILKTLKRDGTMIIFSTHMMDVAAEIGDRILFMKEGKVIQEIKNDGDLENLT
FT                   ITLLQMHRR"
     MTVLNIKEVC KRYKKKIALS PISFQSKQGE CIVLCGGNGA GKSTLLDIIA GITTPTTGTV        60
     QLGNIELQKD RKQYVSEIGY MPDDFHAQQD MTVQEFLFFY AAFRNIGKEK VQAVIKSIGL       120
     NEKKNERLHR LSKGMRQRLL FGQAYLGNPK ILILDEPTNG LDPYWVDEFL TILKTLKRDG       180
     TMIIFSTHMM DVAAEIGDRI LFMKEGKVIQ EIKNDGDLEN LTITLLQMHR R                231
//

If you have problems or comments...

PBIL Back to PBIL home page