(data stored in ACNUC9435 zone)

EMBL: CP000904.PE108

CP000904.PE108       Location/Qualifiers
FT   CDS             complement(155272..156084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5551"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46532"
FT                   /db_xref="GOA:A9VUG1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG1"
FT                   /protein_id="ABY46532.1"
FT                   /translation="MWNILYSEWRSAVRGKLAYMFLFLWITIFSLIFVMERNTPSLVGY
FT                   TNVAGTMVNLILYIVPLLMLIIGAFSIAGEVENGKWRLLCTYPLKSTSYVIGKIIGQFI
FT                   AQTAIFSMSFGVSIIIGLVSGSNFDIFWMVATYIFSVLLIFLFLLLGITIGSFSITRWQ
FT                   ALAISIVVWFFLIMMWPTALISVLNFVPYSMIAPLIKMFLFCNPAEFLRIIFVIQLGGG
FT                   AIFGQVYDQLVMIFQSKAVIWILLIYCIIYTIVFLFVAGWQMERRRKK"
     MWNILYSEWR SAVRGKLAYM FLFLWITIFS LIFVMERNTP SLVGYTNVAG TMVNLILYIV        60
     PLLMLIIGAF SIAGEVENGK WRLLCTYPLK STSYVIGKII GQFIAQTAIF SMSFGVSIII       120
     GLVSGSNFDI FWMVATYIFS VLLIFLFLLL GITIGSFSIT RWQALAISIV VWFFLIMMWP       180
     TALISVLNFV PYSMIAPLIK MFLFCNPAEF LRIIFVIQLG GGAIFGQVYD QLVMIFQSKA       240
     VIWILLIYCI IYTIVFLFVA GWQMERRRKK                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page