(data stored in ACNUC9435 zone)

EMBL: CP000904.PE11

CP000904.PE11        Location/Qualifiers
FT   CDS             30409..31095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5443"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46435"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV03"
FT                   /protein_id="ABY46435.1"
FT                   /translation="MENIENIEVVGEVGIVEHPIFIEKEEPVELPISLEVEHPCWEVDE
FT                   EGYVVEHYLMSDSKIEIALSEGRRVLKSCWKESFYKPRFDEAINDWVEGADMEEILNLF
FT                   KTNKFDELNQACNKDISGYFDAPVGSETYTFSFDGEAQANFIGSLALFNEGLMKEVEWT
FT                   AWKGEKPHRVNLSKEQFMNVAFVAYQEKDTKISKLRNTLQPRIEACTTIEEVQAIYWNE
FT                   KPTLLA"
     MENIENIEVV GEVGIVEHPI FIEKEEPVEL PISLEVEHPC WEVDEEGYVV EHYLMSDSKI        60
     EIALSEGRRV LKSCWKESFY KPRFDEAIND WVEGADMEEI LNLFKTNKFD ELNQACNKDI       120
     SGYFDAPVGS ETYTFSFDGE AQANFIGSLA LFNEGLMKEV EWTAWKGEKP HRVNLSKEQF       180
     MNVAFVAYQE KDTKISKLRN TLQPRIEACT TIEEVQAIYW NEKPTLLA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page