(data stored in ACNUC9435 zone)

EMBL: CP000904.PE110

CP000904.PE110       Location/Qualifiers
FT   CDS             complement(156672..157949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5553"
FT                   /product="Carbohydrate-binding and sugar hydrolysis"
FT                   /note="SMART: Parallel beta-helix repeat;
FT                   Carbohydrate-binding and sugar hydrolysis; KEGG:
FT                   gtn:GTNG_1732 copper binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5553"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46534"
FT                   /db_xref="GOA:A9VUG3"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG3"
FT                   /protein_id="ABY46534.1"
FT                   /translation="MKKICSPLLLLLVFCFPGVSIHAESTLQSKIDAASPYETITLENR
FT                   AYNETIKISKPLTIQGDKNTKIISCGKDPVITINKENIILKDLKIEQCNDNTDQPAIFV
FT                   EGDKHYISGLEVHTSYIGIKLENARDIKIENSMIVGQRRANGIDLWQSNRNLIENIKIQ
FT                   NARDGIYLEQSDNNTIKENTIWQSRYGIHLMYSDRTVVEKNISKENTTGAMIMGTKETS
FT                   VVGNRFIYNKSNVHAQGLLLYDATKTKVLQNEIANNRVGVYVEKADHNTIMDNSISNNF
FT                   IGLQFKDASANEFTQNVMMGNVNESQATQSRENNIYNNYWDASLKVDADGSGTSNIPYK
FT                   ADAYFLLLTQDIPEYQLFFQSPGMRILQSFIKIPDQSLLLDKEPSMRPKGVPQKGEGMA
FT                   FQSNILIVSVSMLLMGSILFILGRKN"
     MKKICSPLLL LLVFCFPGVS IHAESTLQSK IDAASPYETI TLENRAYNET IKISKPLTIQ        60
     GDKNTKIISC GKDPVITINK ENIILKDLKI EQCNDNTDQP AIFVEGDKHY ISGLEVHTSY       120
     IGIKLENARD IKIENSMIVG QRRANGIDLW QSNRNLIENI KIQNARDGIY LEQSDNNTIK       180
     ENTIWQSRYG IHLMYSDRTV VEKNISKENT TGAMIMGTKE TSVVGNRFIY NKSNVHAQGL       240
     LLYDATKTKV LQNEIANNRV GVYVEKADHN TIMDNSISNN FIGLQFKDAS ANEFTQNVMM       300
     GNVNESQATQ SRENNIYNNY WDASLKVDAD GSGTSNIPYK ADAYFLLLTQ DIPEYQLFFQ       360
     SPGMRILQSF IKIPDQSLLL DKEPSMRPKG VPQKGEGMAF QSNILIVSVS MLLMGSILFI       420
     LGRKN                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page