(data stored in ACNUC9435 zone)

EMBL: CP000904.PE111

CP000904.PE111       Location/Qualifiers
FT   CDS             complement(158176..158484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcy:Bcer98_3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5554"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46535"
FT                   /db_xref="InterPro:IPR018690"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG4"
FT                   /protein_id="ABY46535.1"
FT                   /translation="MEHNKKAAIGDYVQFSYRKNPNLQLTGFVVSVLQNTIVVDVSQIM
FT                   KIEVDDVRQVVKHGYYKKVVHAQIKNNIHNSYTAALTNFSFVRNSITTCSNFLTGFM"
     MEHNKKAAIG DYVQFSYRKN PNLQLTGFVV SVLQNTIVVD VSQIMKIEVD DVRQVVKHGY        60
     YKKVVHAQIK NNIHNSYTAA LTNFSFVRNS ITTCSNFLTG FM                          102
//

If you have problems or comments...

PBIL Back to PBIL home page