(data stored in ACNUC9435 zone)

EMBL: CP000904.PE113

CP000904.PE113       Location/Qualifiers
FT   CDS             complement(160521..160775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:BCZK2265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5556"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46537"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG6"
FT                   /protein_id="ABY46537.1"
FT                   /translation="MSIISITKSQDSIMIAWQSAEITIPLKDIITISTNDVPHNKLDHV
FT                   VYIGTPSSSKNRILVHTTNLNFIIFVVNPSIILEEINIE"
     MSIISITKSQ DSIMIAWQSA EITIPLKDII TISTNDVPHN KLDHVVYIGT PSSSKNRILV        60
     HTTNLNFIIF VVNPSIILEE INIE                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page