(data stored in ACNUC9435 zone)

EMBL: CP000904.PE114

CP000904.PE114       Location/Qualifiers
FT   CDS             complement(161740..162399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5557"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: bce:BC2447 chloramphenicol
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5557"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46538"
FT                   /db_xref="GOA:A9VUG7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG7"
FT                   /protein_id="ABY46538.1"
FT                   /translation="MKHPLFNHWSETKYLKDIVTNPLIEVGEYSYYSGYYGHQNFEDSC
FT                   VRYLWGDVKSRALFNPIEQMGWHLDKLIIGNYVCIATGVVILMGGNHNHHSEWVTVYPF
FT                   VEQIKQSFEPKGDTVIKSDAWIGMNAIIMPGVTIGEGAIIAAGSVVSKDVPPYTIVGGN
FT                   PAKEIKKRFTDTEISMLMEMRWFDWNRELVERAIPLLSSPSIEQLYNFYKSEVKNK"
     MKHPLFNHWS ETKYLKDIVT NPLIEVGEYS YYSGYYGHQN FEDSCVRYLW GDVKSRALFN        60
     PIEQMGWHLD KLIIGNYVCI ATGVVILMGG NHNHHSEWVT VYPFVEQIKQ SFEPKGDTVI       120
     KSDAWIGMNA IIMPGVTIGE GAIIAAGSVV SKDVPPYTIV GGNPAKEIKK RFTDTEISML       180
     MEMRWFDWNR ELVERAIPLL SSPSIEQLYN FYKSEVKNK                              219
//

If you have problems or comments...

PBIL Back to PBIL home page