(data stored in ACNUC9435 zone)

EMBL: CP000904.PE115

CP000904.PE115       Location/Qualifiers
FT   CDS             complement(162693..162992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5558"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bat:BAS3065
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5558"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46539"
FT                   /db_xref="GOA:A9VUG8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG8"
FT                   /protein_id="ABY46539.1"
FT                   /translation="MTRFANHHVDNTILEEDVELLKVMAHPMRLKLISELSKHKTLNVT
FT                   QMTEILNIPQSTVSQHLSKMRGKVLKGNRQGLEIYYSIQNPKAEEIMGLLGPVQ"
     MTRFANHHVD NTILEEDVEL LKVMAHPMRL KLISELSKHK TLNVTQMTEI LNIPQSTVSQ        60
     HLSKMRGKVL KGNRQGLEIY YSIQNPKAEE IMGLLGPVQ                               99
//

If you have problems or comments...

PBIL Back to PBIL home page