(data stored in ACNUC9435 zone)

EMBL: CP000904.PE116

CP000904.PE116       Location/Qualifiers
FT   CDS             163597..164052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_2285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5560"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46540"
FT                   /db_xref="InterPro:IPR031998"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUG9"
FT                   /protein_id="ABY46540.1"
FT                   /translation="MDIIGALTIGGSVFSYTAGGITPASAESQFIQKVSPVFDDWQWQN
FT                   YFSLHHNADFLQELALGDLKQGDTFDIRIYTGGKDTGIVKIYRLSEDENEVVNMQRYKT
FT                   IYDTGTKHNYGRFVTPITSVYKPGSYVAVMKLGENYYYYGGSFKIKK"
     MDIIGALTIG GSVFSYTAGG ITPASAESQF IQKVSPVFDD WQWQNYFSLH HNADFLQELA        60
     LGDLKQGDTF DIRIYTGGKD TGIVKIYRLS EDENEVVNMQ RYKTIYDTGT KHNYGRFVTP       120
     ITSVYKPGSY VAVMKLGENY YYYGGSFKIK K                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page