(data stored in ACNUC9435 zone)

EMBL: CP000904.PE117

CP000904.PE117       Location/Qualifiers
FT   CDS             complement(164233..164703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3298 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5561"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46541"
FT                   /db_xref="GOA:A9VUH0"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH0"
FT                   /protein_id="ABY46541.1"
FT                   /translation="MPAAKNIFLQCFHYLHYNVVFLSVLIALTTFNGTSNPIENEGMTN
FT                   MFLKTPGIAIQLFGENIMFVSILFIWHKIIRSFIISPIPSITTSLILSGSSFGLLHLST
FT                   YNYNWVQCLAIIGIPAIAQMIFFLIFKNIHMGYMVHFNYNLIIILFNYIVSI"
     MPAAKNIFLQ CFHYLHYNVV FLSVLIALTT FNGTSNPIEN EGMTNMFLKT PGIAIQLFGE        60
     NIMFVSILFI WHKIIRSFII SPIPSITTSL ILSGSSFGLL HLSTYNYNWV QCLAIIGIPA       120
     IAQMIFFLIF KNIHMGYMVH FNYNLIIILF NYIVSI                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page