(data stored in ACNUC9435 zone)

EMBL: CP000904.PE118

CP000904.PE118       Location/Qualifiers
FT   CDS             complement(166054..166989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5563"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bce:BC1063 transporter,
FT                   drug/metabolite exporter family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5563"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46542"
FT                   /db_xref="GOA:A9VUH1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH1"
FT                   /protein_id="ABY46542.1"
FT                   /translation="MIQQNSIERKSLPALKMIISMVIFGSVGFFSVQTNLPSFELVFVR
FT                   CIFATIFLGLCWLITGQYKHDKWERKEVIQVLICGFFLVFNWVFLFKAFENMSVTVAIS
FT                   VYHLAPIIVLIIGSIVFKEKLTVLSVISIIICFVGALLIAGINKNFSFDSLMSSGMVWG
FT                   LLAALFYAFTTLFGKGIKNMSAYAMTFLQTFLGIFLLIPFIDFDAFHGLTQSNWTYIIA
FT                   TGLIHTGLVYYLFFDSLRDLSTKLISILVFLDPAVAILLDTVLTGFRPTLMQVSGITLI
FT                   FVGMALTFKKSKNKTQKFKKQTIEDDARVL"
     MIQQNSIERK SLPALKMIIS MVIFGSVGFF SVQTNLPSFE LVFVRCIFAT IFLGLCWLIT        60
     GQYKHDKWER KEVIQVLICG FFLVFNWVFL FKAFENMSVT VAISVYHLAP IIVLIIGSIV       120
     FKEKLTVLSV ISIIICFVGA LLIAGINKNF SFDSLMSSGM VWGLLAALFY AFTTLFGKGI       180
     KNMSAYAMTF LQTFLGIFLL IPFIDFDAFH GLTQSNWTYI IATGLIHTGL VYYLFFDSLR       240
     DLSTKLISIL VFLDPAVAIL LDTVLTGFRP TLMQVSGITL IFVGMALTFK KSKNKTQKFK       300
     KQTIEDDARV L                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page