(data stored in ACNUC9435 zone)

EMBL: CP000904.PE119

CP000904.PE119       Location/Qualifiers
FT   CDS             complement(167086..167832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5564"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bce:BC1062 3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5564"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46543"
FT                   /db_xref="GOA:A9VUH2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH2"
FT                   /protein_id="ABY46543.1"
FT                   /translation="MIKNKTIMISGANSGIGNACIEYFLEKSFNVIALDINTNKLVDYT
FT                   KTHTSFKLVQIDLSNSNEINNLFIQLDTDTLCPDILINAAGIREITPVLELSDDLFKKV
FT                   IDVNLVAPFILSREAAKRWYKSKTKGCIVNIASVSGLMAEPERAAYVASKHALIGLTKQ
FT                   MAMEFGKQNIRVNSISPGVIRTELTEEYFSDERLVSLIKSNQSLDTWGLPQDIVSCIEY
FT                   LISDQARFVTGSNFVIDGGWTAGKNL"
     MIKNKTIMIS GANSGIGNAC IEYFLEKSFN VIALDINTNK LVDYTKTHTS FKLVQIDLSN        60
     SNEINNLFIQ LDTDTLCPDI LINAAGIREI TPVLELSDDL FKKVIDVNLV APFILSREAA       120
     KRWYKSKTKG CIVNIASVSG LMAEPERAAY VASKHALIGL TKQMAMEFGK QNIRVNSISP       180
     GVIRTELTEE YFSDERLVSL IKSNQSLDTW GLPQDIVSCI EYLISDQARF VTGSNFVIDG       240
     GWTAGKNL                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page