(data stored in ACNUC9435 zone)

EMBL: CP000904.PE12

CP000904.PE12        Location/Qualifiers
FT   CDS             31169..31381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5444"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46436"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV04"
FT                   /protein_id="ABY46436.1"
FT                   /translation="MGQQGNTTNIDVNLLIKEYEATIITLISENVKYKTLLKQRAIEEQ
FT                   QRQEEMMRHEAPPAPPAVPSEEVVA"
     MGQQGNTTNI DVNLLIKEYE ATIITLISEN VKYKTLLKQR AIEEQQRQEE MMRHEAPPAP        60
     PAVPSEEVVA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page