(data stored in ACNUC9435 zone)

EMBL: CP000904.PE120

CP000904.PE120       Location/Qualifiers
FT   CDS             complement(167829..168569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bce:BC1061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5565"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46544"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH3"
FT                   /protein_id="ABY46544.1"
FT                   /translation="MLTTVSNKTSSFDVEQKVHEFESNGYIQIFNDIFLQDQEDQALLT
FT                   KAQLDYYSLQNDAYGECRARAYSRYIKYAGSSDYVLDTDNGYFQSEEYNYDDGGKIRNF
FT                   NSITDEFLHNSLIEKIVRFDSEFASNTNILDTSKDLVIGLHQVRYKATRENPSFSSPIW
FT                   LHKDDEPIVFLHLMNLSNTALGGDNLIANSPREINKLISLKDPLETLVFGQKVFHAVTP
FT                   LGTECNTEALRDILLVTFSYKEPK"
     MLTTVSNKTS SFDVEQKVHE FESNGYIQIF NDIFLQDQED QALLTKAQLD YYSLQNDAYG        60
     ECRARAYSRY IKYAGSSDYV LDTDNGYFQS EEYNYDDGGK IRNFNSITDE FLHNSLIEKI       120
     VRFDSEFASN TNILDTSKDL VIGLHQVRYK ATRENPSFSS PIWLHKDDEP IVFLHLMNLS       180
     NTALGGDNLI ANSPREINKL ISLKDPLETL VFGQKVFHAV TPLGTECNTE ALRDILLVTF       240
     SYKEPK                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page