(data stored in ACNUC9435 zone)

EMBL: CP000904.PE121

CP000904.PE121       Location/Qualifiers
FT   CDS             169599..170204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5567"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bld:BLi01487 YrkC"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5567"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46545"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH4"
FT                   /protein_id="ABY46545.1"
FT                   /translation="MYYAPFMYRYQYPYYVNVPMYNYGRQSVYWTSPNEIEYVKRFDSF
FT                   SFSNGDESILLKDYGSEPFVVNINEATKQNNTYRKALWTGTHLQVTLMSLNVGKDIGLE
FT                   IHPGVDQFLRIEQGQGIVQMGKSKDNLNLKRNVYADFAIMIPAGTWHNLTNTGNVPLKL
FT                   YSIYAPPNHPFGTVHVTKTDALTVEEGYSHGNRNTVSY"
     MYYAPFMYRY QYPYYVNVPM YNYGRQSVYW TSPNEIEYVK RFDSFSFSNG DESILLKDYG        60
     SEPFVVNINE ATKQNNTYRK ALWTGTHLQV TLMSLNVGKD IGLEIHPGVD QFLRIEQGQG       120
     IVQMGKSKDN LNLKRNVYAD FAIMIPAGTW HNLTNTGNVP LKLYSIYAPP NHPFGTVHVT       180
     KTDALTVEEG YSHGNRNTVS Y                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page