(data stored in ACNUC9435 zone)

EMBL: CP000904.PE122

CP000904.PE122       Location/Qualifiers
FT   CDS             complement(170766..172085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5569"
FT                   /product="aromatic amino acid permease"
FT                   /note="PFAM: aromatic amino acid permease; Amino acid
FT                   transporter transmembrane; KEGG: bat:BAS3066
FT                   serine/threonine transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5569"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46546"
FT                   /db_xref="GOA:A9VUH5"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH5"
FT                   /protein_id="ABY46546.1"
FT                   /translation="MNGNTAKKIEFQAENTAVKNEKYPDPTKWHKQDTTWALSLFGTAI
FT                   GAGVLFLPINAGSGGLLSLLLITLLAYPVMYYSHRALAKMIYASNSAEEGITGTIREYF
FT                   GNKASIIFNIVYFVSIYTIVLMYSVALTNTASSFIVHQLHMQEPPRAILSLVLVLGLIA
FT                   ILNFGQDITVKIMSMLVYPFIASLLFISISLIPQWNTSMLSFSSVSTASTGTGYLGTIW
FT                   MILPIIVFSFNHSPMISSFVMKQRATYGIEATDAKCAQIQKVCYIMTFAVVMFFVWSST
FT                   LSLTPNDLMMAKEQNLSILSYLANELNSPVITIAAPIIAFVAITKSFLGHYIGAYEVMR
FT                   DMIIKSGKTRGKDIGEKTVKTMILTFVVLTCWYVAYANPSILGIIDALSGPLVAAILCL
FT                   LPMYAIRKVPVLAKYRGKMSNVFVIIIGILTVLASIKSLF"
     MNGNTAKKIE FQAENTAVKN EKYPDPTKWH KQDTTWALSL FGTAIGAGVL FLPINAGSGG        60
     LLSLLLITLL AYPVMYYSHR ALAKMIYASN SAEEGITGTI REYFGNKASI IFNIVYFVSI       120
     YTIVLMYSVA LTNTASSFIV HQLHMQEPPR AILSLVLVLG LIAILNFGQD ITVKIMSMLV       180
     YPFIASLLFI SISLIPQWNT SMLSFSSVST ASTGTGYLGT IWMILPIIVF SFNHSPMISS       240
     FVMKQRATYG IEATDAKCAQ IQKVCYIMTF AVVMFFVWSS TLSLTPNDLM MAKEQNLSIL       300
     SYLANELNSP VITIAAPIIA FVAITKSFLG HYIGAYEVMR DMIIKSGKTR GKDIGEKTVK       360
     TMILTFVVLT CWYVAYANPS ILGIIDALSG PLVAAILCLL PMYAIRKVPV LAKYRGKMSN       420
     VFVIIIGILT VLASIKSLF                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page