(data stored in ACNUC9435 zone)

EMBL: CP000904.PE123

CP000904.PE123       Location/Qualifiers
FT   CDS             complement(172383..173270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5570"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: bat:BAS3067 L-serine dehydratase,
FT                   iron-sulfur-dependent, alpha subunit; TIGRFAM: L-serine
FT                   dehydratase, iron-sulfur-dependent, alpha subunit; PFAM:
FT                   serine dehydratase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5570"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46547"
FT                   /db_xref="GOA:A9VUH6"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH6"
FT                   /protein_id="ABY46547.1"
FT                   /translation="MYMTIREIVDAANKSQKPIYELAIEQEIEQTKTSYEEAWSKMERN
FT                   LATMENAINKSIEGDGVFSPTGLTGGDAVKIKYYRENRKTLSGDLMVLGIQSAIGVNEV
FT                   NAALGAICATPTAGASGTIPGVLYSIKDTMQLTHEDMIHFLFTSALLGTIVANNACISG
FT                   AYGGCQAEVGSASAMAAAAAVEVAGGTPQQSSEAFSTALQNLLGLVCDPVAGLVEIPCV
FT                   KRNAIGTANALAAADIALAGVNNIINADEVIEAMYRVGRQMPRELRETGLGGIAATPTG
FT                   IAIKNKIFGEKQSN"
     MYMTIREIVD AANKSQKPIY ELAIEQEIEQ TKTSYEEAWS KMERNLATME NAINKSIEGD        60
     GVFSPTGLTG GDAVKIKYYR ENRKTLSGDL MVLGIQSAIG VNEVNAALGA ICATPTAGAS       120
     GTIPGVLYSI KDTMQLTHED MIHFLFTSAL LGTIVANNAC ISGAYGGCQA EVGSASAMAA       180
     AAAVEVAGGT PQQSSEAFST ALQNLLGLVC DPVAGLVEIP CVKRNAIGTA NALAAADIAL       240
     AGVNNIINAD EVIEAMYRVG RQMPRELRET GLGGIAATPT GIAIKNKIFG EKQSN            295
//

If you have problems or comments...

PBIL Back to PBIL home page