(data stored in ACNUC9435 zone)

EMBL: CP000904.PE124

CP000904.PE124       Location/Qualifiers
FT   CDS             complement(173293..173991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5571"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /note="TIGRFAM: L-serine dehydratase,
FT                   iron-sulfur-dependent, beta subunit; PFAM: serine
FT                   dehydratase beta chain; KEGG: bat:BAS3068 L-serine
FT                   dehydratase, iron-sulfur-dependent, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5571"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46548"
FT                   /db_xref="GOA:A9VUH7"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH7"
FT                   /protein_id="ABY46548.1"
FT                   /translation="MNMNVASIKEKKVVKYKSCFDVIGPVMIGPSSSHTAGALAIGTVA
FT                   NKLFQGLPKKVVVRYYESFAETHKGHGTDFAIIAGILGFAADDSKVPDAIKIAESKGID
FT                   ITFIEKAGDSPAGHPNTADVYLEDESRSIRTMGISVGGGLIEVKHVEIDGFSLDLQGPL
FT                   PVIIAISERADFEFVLRRVFKQYDVEINNFHSLEENRKYLYAFALDSLLPGYVQKELGN
FT                   LSNIANVIIL"
     MNMNVASIKE KKVVKYKSCF DVIGPVMIGP SSSHTAGALA IGTVANKLFQ GLPKKVVVRY        60
     YESFAETHKG HGTDFAIIAG ILGFAADDSK VPDAIKIAES KGIDITFIEK AGDSPAGHPN       120
     TADVYLEDES RSIRTMGISV GGGLIEVKHV EIDGFSLDLQ GPLPVIIAIS ERADFEFVLR       180
     RVFKQYDVEI NNFHSLEENR KYLYAFALDS LLPGYVQKEL GNLSNIANVI IL               232
//

If you have problems or comments...

PBIL Back to PBIL home page