(data stored in ACNUC9435 zone)

EMBL: CP000904.PE126

CP000904.PE126       Location/Qualifiers
FT   CDS             175365..176912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5573"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   bat:BAS3369 spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5573"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46550"
FT                   /db_xref="GOA:A9VUH9"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUH9"
FT                   /protein_id="ABY46550.1"
FT                   /translation="MAKFLKRLKYRDNPKSFSIRDNTHFQKKNIEDSLLGADLSKNIAD
FT                   IQNIFRQAPDLVIRRFQIKADGLEAGLVYLSGLTDKELIQNHVLSPLMNSDFDTNTELP
FT                   IPLGQIKIINTWSQIENAIFGGDSVLLIHTRTTAHQLDTKGWPQRNVEDAHNEIALKGA
FT                   HQGFTEIRSQNIAMIRRYIPHRELTVKEIVIGVRSKTRISILYLKDVASEDVLKELETR
FT                   IHNITVDAVASNGELIEFIEDNPYSPFPQFILTERPDLAVSHILQGRFVTVMDHSPNVL
FT                   IAPTNFISFFQGVDDYGTRWLVASSIRMLRFISFIIALFLPASYVAFISFNFEVIPVEL
FT                   YLSIAESRTRVPFSPVMEALLMEITLETMREGALRIPTPIGQTVGVVGGIVIGQAAVQA
FT                   GIVSNIMIIVVAITAISSFVIPNYDMGAAVRLLRFPMMLAAALFGIVGLVIGWMTLIGH
FT                   LISLESLGTPYGTPLAPFRFADMKDAFLRFPLWAIRRRPKGNGTIQSIRQGKNPNKR"
     MAKFLKRLKY RDNPKSFSIR DNTHFQKKNI EDSLLGADLS KNIADIQNIF RQAPDLVIRR        60
     FQIKADGLEA GLVYLSGLTD KELIQNHVLS PLMNSDFDTN TELPIPLGQI KIINTWSQIE       120
     NAIFGGDSVL LIHTRTTAHQ LDTKGWPQRN VEDAHNEIAL KGAHQGFTEI RSQNIAMIRR       180
     YIPHRELTVK EIVIGVRSKT RISILYLKDV ASEDVLKELE TRIHNITVDA VASNGELIEF       240
     IEDNPYSPFP QFILTERPDL AVSHILQGRF VTVMDHSPNV LIAPTNFISF FQGVDDYGTR       300
     WLVASSIRML RFISFIIALF LPASYVAFIS FNFEVIPVEL YLSIAESRTR VPFSPVMEAL       360
     LMEITLETMR EGALRIPTPI GQTVGVVGGI VIGQAAVQAG IVSNIMIIVV AITAISSFVI       420
     PNYDMGAAVR LLRFPMMLAA ALFGIVGLVI GWMTLIGHLI SLESLGTPYG TPLAPFRFAD       480
     MKDAFLRFPL WAIRRRPKGN GTIQSIRQGK NPNKR                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page