(data stored in ACNUC9435 zone)

EMBL: CP000904.PE127

CP000904.PE127       Location/Qualifiers
FT   CDS             176917..178020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5574"
FT                   /product="spore germination protein"
FT                   /note="TIGRFAM: spore germination protein; PFAM: Spore
FT                   germination protein; KEGG: btk:BT9727_3333 spore
FT                   germination protein; amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5574"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46551"
FT                   /db_xref="GOA:A9VUI0"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI0"
FT                   /protein_id="ABY46551.1"
FT                   /translation="MKKYAYNDITLMQYIVLINGMQVATGVLSLPRVLAENAGTDGWIA
FT                   ILIGWIFSTISGVFIVKTAARYPEDTIYDILIRLFGKIVGKAFVVIYMMYFAFYTCIVL
FT                   VNAMLFLKGWLLPKTPDYIVIFLFSIPTFFVARNGPRIIGRYSELFLYMALWIPLFFLI
FT                   PLKENGSWMPFFPLLKEGWKPVLTAVPTTIFAYLGFDIAFFLYPFLQKKQYAVHGMVIA
FT                   NTLTMLFYLFTTIVCFAYFSPDSITQYNQPVLNLVKVIEFRFLERFDMILLAVYLTIVS
FT                   TSWIPALYCSVFCSSQLLGKQDHSSHVVVLLLLIIGIIFWTHPSWNEAEIWQQVFSNAG
FT                   LGLTYILPIILWLYCCLYEKFRQGRIH"
     MKKYAYNDIT LMQYIVLING MQVATGVLSL PRVLAENAGT DGWIAILIGW IFSTISGVFI        60
     VKTAARYPED TIYDILIRLF GKIVGKAFVV IYMMYFAFYT CIVLVNAMLF LKGWLLPKTP       120
     DYIVIFLFSI PTFFVARNGP RIIGRYSELF LYMALWIPLF FLIPLKENGS WMPFFPLLKE       180
     GWKPVLTAVP TTIFAYLGFD IAFFLYPFLQ KKQYAVHGMV IANTLTMLFY LFTTIVCFAY       240
     FSPDSITQYN QPVLNLVKVI EFRFLERFDM ILLAVYLTIV STSWIPALYC SVFCSSQLLG       300
     KQDHSSHVVV LLLLIIGIIF WTHPSWNEAE IWQQVFSNAG LGLTYILPII LWLYCCLYEK       360
     FRQGRIH                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page