(data stored in ACNUC9435 zone)

EMBL: CP000904.PE128

CP000904.PE128       Location/Qualifiers
FT   CDS             178062..179120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5575"
FT                   /product="spore germination B3 GerAC family protein"
FT                   /note="PFAM: spore germination B3 GerAC family protein;
FT                   KEGG: btl:BALH_3215 spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5575"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46552"
FT                   /db_xref="GOA:A9VUI1"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI1"
FT                   /protein_id="ABY46552.1"
FT                   /translation="MTGCFDQTNVEDVSLTLVLGIDLDRNDNLLVYISSPVFNKEAKIK
FT                   EETTGVKSATVRKSRDQFDATVMALTAGSKTQVILVGKRLLKRKNWENHLDPFYRDPKN
FT                   TVTARVVAVDGPVSDVIFYSPKDKPRLPIYLTKLVDTASLRNITVKTTLQELYEQRADK
FT                   GVTANITEVKKKNKIWVTGTALLDEKGKYKLTLKSDETKLLRILQQRTTGEFPFTIPIK
FT                   LKSDSQDKDWISFTANGIKVKTKARYDNHFIFNVDVKMRIGITERLFSFNTKKDAAKLQ
FT                   KAIETKLEADFKQLIQKMQTSKIDPIGLGGYARTYTYPEWKKVQNKWNNELAKGDVNVK
FT                   VKIKIGGMGTIK"
     MTGCFDQTNV EDVSLTLVLG IDLDRNDNLL VYISSPVFNK EAKIKEETTG VKSATVRKSR        60
     DQFDATVMAL TAGSKTQVIL VGKRLLKRKN WENHLDPFYR DPKNTVTARV VAVDGPVSDV       120
     IFYSPKDKPR LPIYLTKLVD TASLRNITVK TTLQELYEQR ADKGVTANIT EVKKKNKIWV       180
     TGTALLDEKG KYKLTLKSDE TKLLRILQQR TTGEFPFTIP IKLKSDSQDK DWISFTANGI       240
     KVKTKARYDN HFIFNVDVKM RIGITERLFS FNTKKDAAKL QKAIETKLEA DFKQLIQKMQ       300
     TSKIDPIGLG GYARTYTYPE WKKVQNKWNN ELAKGDVNVK VKIKIGGMGT IK               352
//

If you have problems or comments...

PBIL Back to PBIL home page