(data stored in ACNUC9435 zone)

EMBL: CP000904.PE129

CP000904.PE129       Location/Qualifiers
FT   CDS             complement(179454..180269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btl:BALH_2453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5576"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46553"
FT                   /db_xref="GOA:A9VUI2"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI2"
FT                   /protein_id="ABY46553.1"
FT                   /translation="MSFSNELKKAMKQEVPKEVKERAYQSFTQIHKRENKNKLKKKLLI
FT                   TGVAAAIIIPTSTMALNNSYFTQPQLKLNDMITDQVRKYAAAGKSIPLDQKITDQGITL
FT                   HLKEMLLQEDKILVYYRFEQQDGSLIPYEFNTNGLHIVSSGKEKGKQVARPTYKNEKFN
FT                   TVSELGFLSNNNLDSYQKDRIGNPNAPDIGMFYLTNATGKAFETALAFHDKPEGTVVFE
FT                   VLQGERFPNSLTINININRVGKTEGNWITKILIDVEHKSVQKTDMDKNQ"
     MSFSNELKKA MKQEVPKEVK ERAYQSFTQI HKRENKNKLK KKLLITGVAA AIIIPTSTMA        60
     LNNSYFTQPQ LKLNDMITDQ VRKYAAAGKS IPLDQKITDQ GITLHLKEML LQEDKILVYY       120
     RFEQQDGSLI PYEFNTNGLH IVSSGKEKGK QVARPTYKNE KFNTVSELGF LSNNNLDSYQ       180
     KDRIGNPNAP DIGMFYLTNA TGKAFETALA FHDKPEGTVV FEVLQGERFP NSLTINININ       240
     RVGKTEGNWI TKILIDVEHK SVQKTDMDKN Q                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page