(data stored in ACNUC9435 zone)

EMBL: CP000904.PE13

CP000904.PE13        Location/Qualifiers
FT   CDS             31461..31853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5445"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46437"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV05"
FT                   /protein_id="ABY46437.1"
FT                   /translation="MEVFFCMTQVRIRSITKDEKSPWVYIQEETRQETPKANVFQVKAE
FT                   PVIRRNTKTNQYGRFRYSEMQYGRIEAILASALEISKSPMRIRNQNGEWVYIQQTTIDG
FT                   ACPAIRIRNRYSEQAGPWVYIQHKEV"
     MEVFFCMTQV RIRSITKDEK SPWVYIQEET RQETPKANVF QVKAEPVIRR NTKTNQYGRF        60
     RYSEMQYGRI EAILASALEI SKSPMRIRNQ NGEWVYIQQT TIDGACPAIR IRNRYSEQAG       120
     PWVYIQHKEV                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page