(data stored in ACNUC9435 zone)

EMBL: CP000904.PE130

CP000904.PE130       Location/Qualifiers
FT   CDS             complement(180253..180837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5577"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: bat:BAS2758 RNA polymerase
FT                   sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5577"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46554"
FT                   /db_xref="GOA:A9VUI3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI3"
FT                   /protein_id="ABY46554.1"
FT                   /translation="MATNDNISTWIDRLLSGDEEAFEYIFDLTNQRIYDTVFAIVKNGH
FT                   DTNEIVNEVYFQLWKSISKYDQSRPFLFWLNGIVYKQISQWRKQVWKRMRLFEKQHSMQ
FT                   ESVVEIPEKLLLEKETQKELLTLIQELPFKFRVVIVYRFYHDYTYEEIAELLQIPIGTV
FT                   RSRIHRALEKIRNQSNIEIDEEEYNSNVIFK"
     MATNDNISTW IDRLLSGDEE AFEYIFDLTN QRIYDTVFAI VKNGHDTNEI VNEVYFQLWK        60
     SISKYDQSRP FLFWLNGIVY KQISQWRKQV WKRMRLFEKQ HSMQESVVEI PEKLLLEKET       120
     QKELLTLIQE LPFKFRVVIV YRFYHDYTYE EIAELLQIPI GTVRSRIHRA LEKIRNQSNI       180
     EIDEEEYNSN VIFK                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page