(data stored in ACNUC9435 zone)

EMBL: CP000904.PE131

CP000904.PE131       Location/Qualifiers
FT   CDS             complement(181083..181406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5578"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46555"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI4"
FT                   /protein_id="ABY46555.1"
FT                   /translation="MDIKYDEYELLELFESEPEDFLIEGAGVYLYRKMDHLGFKLITIM
FT                   SVYENTIKLSLSYNEGCVFDVNMEFVERVYTRNDILHIQCSEEKKAIEVRFKPHFAINI
FT                   REF"
     MDIKYDEYEL LELFESEPED FLIEGAGVYL YRKMDHLGFK LITIMSVYEN TIKLSLSYNE        60
     GCVFDVNMEF VERVYTRNDI LHIQCSEEKK AIEVRFKPHF AINIREF                     107
//

If you have problems or comments...

PBIL Back to PBIL home page