(data stored in ACNUC9435 zone)

EMBL: CP000904.PE132

CP000904.PE132       Location/Qualifiers
FT   CDS             complement(181446..181727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5579"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46556"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI5"
FT                   /protein_id="ABY46556.1"
FT                   /translation="MAPDTLGIRAELNSRAKEMAAKKGYKLGSAEYNELFSKIDPRGMT
FT                   PNVVEDIIKTGSRAPADTPGTWKYSRADGYVILNDNGDVITAVPAKKK"
     MAPDTLGIRA ELNSRAKEMA AKKGYKLGSA EYNELFSKID PRGMTPNVVE DIIKTGSRAP        60
     ADTPGTWKYS RADGYVILND NGDVITAVPA KKK                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page