(data stored in ACNUC9435 zone)

EMBL: CP000904.PE133

CP000904.PE133       Location/Qualifiers
FT   CDS             complement(182265..182501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5581"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   bja:bsl4953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5581"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46557"
FT                   /db_xref="GOA:A9VUI6"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI6"
FT                   /protein_id="ABY46557.1"
FT                   /translation="MPIATIKTFKGALSKEQKVELHKRFADLMVEIEGKGNEEFRKFVI
FT                   LAIEEEEPINMGIGGVGGTDDIVKRITGIKEQS"
     MPIATIKTFK GALSKEQKVE LHKRFADLMV EIEGKGNEEF RKFVILAIEE EEPINMGIGG        60
     VGGTDDIVKR ITGIKEQS                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page