(data stored in ACNUC9435 zone)

EMBL: CP000904.PE134

CP000904.PE134       Location/Qualifiers
FT   CDS             complement(182568..183164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5582"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dps:DP2317
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5582"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46558"
FT                   /db_xref="GOA:A9VUI7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI7"
FT                   /protein_id="ABY46558.1"
FT                   /translation="MNTNKVEKTKAYIIKKTLPIFNKKGYYGTSLSDITNATKLTKGSI
FT                   YGNFKDKDDVAVNCFLFNVNNITDEIYNNMQGAKNSLEKLLVFPKIYRKIFKDIIANGG
FT                   CPIANTLIESDDTHPILLKLALDTLYRLENFLVSIIEEGLLYGEFIETTESHKTVQTII
FT                   TLCEGGMILTKSTKKESYLINAIETIEEIIYSLKK"
     MNTNKVEKTK AYIIKKTLPI FNKKGYYGTS LSDITNATKL TKGSIYGNFK DKDDVAVNCF        60
     LFNVNNITDE IYNNMQGAKN SLEKLLVFPK IYRKIFKDII ANGGCPIANT LIESDDTHPI       120
     LLKLALDTLY RLENFLVSII EEGLLYGEFI ETTESHKTVQ TIITLCEGGM ILTKSTKKES       180
     YLINAIETIE EIIYSLKK                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page