(data stored in ACNUC9435 zone)

EMBL: CP000904.PE135

CP000904.PE135       Location/Qualifiers
FT   CDS             complement(183515..183826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5583"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   btl:BALH_4674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5583"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46559"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI8"
FT                   /protein_id="ABY46559.1"
FT                   /translation="MIVTTTNTIQGKEIIEYVDIVNGEAIMGANIVRDIFASVRDVVGG
FT                   RSGAYESKLKEARDIAMEEMKQLATQKGANAIVGIDVDYEVVRDGMLMVAVSGTAVRV"
     MIVTTTNTIQ GKEIIEYVDI VNGEAIMGAN IVRDIFASVR DVVGGRSGAY ESKLKEARDI        60
     AMEEMKQLAT QKGANAIVGI DVDYEVVRDG MLMVAVSGTA VRV                         103
//

If you have problems or comments...

PBIL Back to PBIL home page