(data stored in ACNUC9435 zone)

EMBL: CP000904.PE136

CP000904.PE136       Location/Qualifiers
FT   CDS             complement(184041..186254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5584"
FT                   /product="putative cell wall binding repeat-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat-containing
FT                   protein; KEGG: cpf:CPF_0490 cell wall binding repeat domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5584"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46560"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUI9"
FT                   /protein_id="ABY46560.1"
FT                   /translation="MKKKFKTIGIGKKVIPTAAALGILFSVAPIAENKASAGIGTVIDI
FT                   SITVLGAVANTYEALGINPENPDPGTHIDVYAENETYQAPSFTSGEFNISMYHTQGDVN
FT                   FLKPVKVRYPNGRIEIHQLKSGQQLKITEAGAIIDLNPNGANVSEHDLLYITQAQLDEG
FT                   KTGVVINQGQHAFVEKASGKNPRFLGPLYKKYSGDSFGDWTVIARNSDYLFDQIANKLS
FT                   DKQKQLITLTSKPVSKDVLDTYVNNEPKARADFYDRLSDILAERTNVLETSIALPFTTL
FT                   NDGKSYQIIPYKKGTNKVIVKTGSKYLSGKEGNRLQYSDSLGDDEVFELVQIGNSYDDK
FT                   FQFRLNNKNGVSLAGNQNIHGFATDWSFKSEIRFPDKSNNEIHNWLIEWYPGKENERQK
FT                   YDKIEMIKNEKDPTKYSAKDSSGNVIKNSWVNRENQYFFADAEGVILTGWQEIKGKTYY
FT                   FSSPYGQMVTGGGSDSLIDGKFYNFNDSGVLQRSVWRGNNYSDASGEFVKEGLKDIDGK
FT                   VYYFKDYHPTTNELPIKDQDVTLHFSDKGVIERVSKLNGEAINSSVNVKLDNKTLAFNQ
FT                   DGSILKTGINKNANTIAYYSLEDGPSYTGWKMIDGKRYYFTNGFNDTFNDYKNIDGKKY
FT                   YFHEDGSVNRAGFEKTDGKLYHFDNNGVAQTGWQTIDNKYYYFDENGAAKTGWFQVGGG
FT                   YRPWPLAYGYLWYCAREDGSLYSDGWFKIDGKDYHFDQWGHKM"
     MKKKFKTIGI GKKVIPTAAA LGILFSVAPI AENKASAGIG TVIDISITVL GAVANTYEAL        60
     GINPENPDPG THIDVYAENE TYQAPSFTSG EFNISMYHTQ GDVNFLKPVK VRYPNGRIEI       120
     HQLKSGQQLK ITEAGAIIDL NPNGANVSEH DLLYITQAQL DEGKTGVVIN QGQHAFVEKA       180
     SGKNPRFLGP LYKKYSGDSF GDWTVIARNS DYLFDQIANK LSDKQKQLIT LTSKPVSKDV       240
     LDTYVNNEPK ARADFYDRLS DILAERTNVL ETSIALPFTT LNDGKSYQII PYKKGTNKVI       300
     VKTGSKYLSG KEGNRLQYSD SLGDDEVFEL VQIGNSYDDK FQFRLNNKNG VSLAGNQNIH       360
     GFATDWSFKS EIRFPDKSNN EIHNWLIEWY PGKENERQKY DKIEMIKNEK DPTKYSAKDS       420
     SGNVIKNSWV NRENQYFFAD AEGVILTGWQ EIKGKTYYFS SPYGQMVTGG GSDSLIDGKF       480
     YNFNDSGVLQ RSVWRGNNYS DASGEFVKEG LKDIDGKVYY FKDYHPTTNE LPIKDQDVTL       540
     HFSDKGVIER VSKLNGEAIN SSVNVKLDNK TLAFNQDGSI LKTGINKNAN TIAYYSLEDG       600
     PSYTGWKMID GKRYYFTNGF NDTFNDYKNI DGKKYYFHED GSVNRAGFEK TDGKLYHFDN       660
     NGVAQTGWQT IDNKYYYFDE NGAAKTGWFQ VGGGYRPWPL AYGYLWYCAR EDGSLYSDGW       720
     FKIDGKDYHF DQWGHKM                                                      737
//

If you have problems or comments...

PBIL Back to PBIL home page