(data stored in ACNUC9435 zone)

EMBL: CP000904.PE137

CP000904.PE137       Location/Qualifiers
FT   CDS             186850..188049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5585"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46561"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ0"
FT                   /protein_id="ABY46561.1"
FT                   /translation="MKGKIKRCIKKIPPVGIAMGIVFSLNPFTKHKAKADVDTFATIVT
FT                   TFGDTYDSFLKEPFVISLSEQSAKNDYLANNENRAYKAPTFNKGEFGISAYDYYKNQNF
FT                   SKRIKLFYKDGKVEYKTIKHGQQLLIKQAGIIVDLNPDASDLYEHDILYITQKQLDEGN
FT                   TGIALTNWQTYYLKSDNSGQMNGPLALKYIRQEFPNIKPGSASFDLEKLFHALPEEKRK
FT                   LATITSNPVKPSEIFSYTSDELAEIKRHKLAVVTQYKNEECSSISMKIRNRDNVLRTWE
FT                   DSMNISASSNWIPEDRSIFTIIPIKKGSNKVYIEANSTYLTSANGEVGVTGFRAYGQVW
FT                   TLVNYGFESFSLKNNHGQYLSVNDTSVCLTDKPDKNTIFPITIQKEKWNEWLAKWYSSK
FT                   "
     MKGKIKRCIK KIPPVGIAMG IVFSLNPFTK HKAKADVDTF ATIVTTFGDT YDSFLKEPFV        60
     ISLSEQSAKN DYLANNENRA YKAPTFNKGE FGISAYDYYK NQNFSKRIKL FYKDGKVEYK       120
     TIKHGQQLLI KQAGIIVDLN PDASDLYEHD ILYITQKQLD EGNTGIALTN WQTYYLKSDN       180
     SGQMNGPLAL KYIRQEFPNI KPGSASFDLE KLFHALPEEK RKLATITSNP VKPSEIFSYT       240
     SDELAEIKRH KLAVVTQYKN EECSSISMKI RNRDNVLRTW EDSMNISASS NWIPEDRSIF       300
     TIIPIKKGSN KVYIEANSTY LTSANGEVGV TGFRAYGQVW TLVNYGFESF SLKNNHGQYL       360
     SVNDTSVCLT DKPDKNTIFP ITIQKEKWNE WLAKWYSSK                              399
//

If you have problems or comments...

PBIL Back to PBIL home page