(data stored in ACNUC9435 zone)

EMBL: CP000904.PE138

CP000904.PE138       Location/Qualifiers
FT   CDS             complement(188363..189040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5586"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: btl:BALH_1747 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5586"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46562"
FT                   /db_xref="GOA:A9VUJ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ1"
FT                   /protein_id="ABY46562.1"
FT                   /translation="MTTILVVEEGITIRNFIVLIMNRAGFNALAADTGETALELLGKHN
FT                   VDIILIDVMLPGIDGFQVCKSIRENNKNIGIIMLSARVQDRDKVQGLTIGADDYIEKPF
FT                   SSIELTARVQALLRRVKGNKENMESIHSEPFRLNLQQERLYKEGVVIDLTPTEYIILRC
FT                   LMENQGKPISRDELLNEIWGVNYVVKTKVIGVNIRRLRQKIEPNPSGPQFLRTVWGKGY
FT                   VWR"
     MTTILVVEEG ITIRNFIVLI MNRAGFNALA ADTGETALEL LGKHNVDIIL IDVMLPGIDG        60
     FQVCKSIREN NKNIGIIMLS ARVQDRDKVQ GLTIGADDYI EKPFSSIELT ARVQALLRRV       120
     KGNKENMESI HSEPFRLNLQ QERLYKEGVV IDLTPTEYII LRCLMENQGK PISRDELLNE       180
     IWGVNYVVKT KVIGVNIRRL RQKIEPNPSG PQFLRTVWGK GYVWR                       225
//

If you have problems or comments...

PBIL Back to PBIL home page