(data stored in ACNUC9435 zone)

EMBL: CP000904.PE14

CP000904.PE14        Location/Qualifiers
FT   CDS             31856..32605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5446"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46438"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV06"
FT                   /protein_id="ABY46438.1"
FT                   /translation="MEYLDNYLSVLPNYDRKEVEQLLQENMDLFDVKVITKEEFEALIQ
FT                   QLANRKEKVTTLTTTGEKVDAEHFNQIHSNVALDLKRLYNSHLIVEKVIANYDRILRGT
FT                   LDDVKREVDSLSTRVEELNLKAKGEDGLVVKTYGFEEKEKSLYMETDHDQYAHLFLDRD
FT                   GKSLQSASLNRSFHQHYLSLPIREVENTMQNSNGATTAKIEVMYQAPNSISDKNHPLEH
FT                   AIDDSLETYWAQAVKTNASAYTEIKKL"
     MEYLDNYLSV LPNYDRKEVE QLLQENMDLF DVKVITKEEF EALIQQLANR KEKVTTLTTT        60
     GEKVDAEHFN QIHSNVALDL KRLYNSHLIV EKVIANYDRI LRGTLDDVKR EVDSLSTRVE       120
     ELNLKAKGED GLVVKTYGFE EKEKSLYMET DHDQYAHLFL DRDGKSLQSA SLNRSFHQHY       180
     LSLPIREVEN TMQNSNGATT AKIEVMYQAP NSISDKNHPL EHAIDDSLET YWAQAVKTNA       240
     SAYTEIKKL                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page