(data stored in ACNUC9435 zone)

EMBL: CP000904.PE140

CP000904.PE140       Location/Qualifiers
FT   CDS             complement(190019..190501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5589"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46564"
FT                   /db_xref="GOA:A9VUJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ3"
FT                   /protein_id="ABY46564.1"
FT                   /translation="MNTLIYNNDDGVNKMKQAKLNITLSLIQLFALVINLCMCSSTMRF
FT                   LPWFVKGAVRCYEIFLTAPLLLITGTVMTYHNTRKRHSILPIRQCISFITIIFFVSTFL
FT                   LPSTDEIVITSLIFNFGMVVITIVFLLKDIAQLNKNRKYRIKKKRIRRHSFGERMK"
     MNTLIYNNDD GVNKMKQAKL NITLSLIQLF ALVINLCMCS STMRFLPWFV KGAVRCYEIF        60
     LTAPLLLITG TVMTYHNTRK RHSILPIRQC ISFITIIFFV STFLLPSTDE IVITSLIFNF       120
     GMVVITIVFL LKDIAQLNKN RKYRIKKKRI RRHSFGERMK                             160
//

If you have problems or comments...

PBIL Back to PBIL home page