(data stored in ACNUC9435 zone)

EMBL: CP000904.PE143

CP000904.PE143       Location/Qualifiers
FT   CDS             complement(193378..194511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5593"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="KEGG: gtn:GTNG_3381 alanine dehydrogenase; TIGRFAM:
FT                   alanine dehydrogenase; PFAM: tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase; alanine dehydrogenase/PNT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5593"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46567"
FT                   /db_xref="GOA:A9VUJ6"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ6"
FT                   /protein_id="ABY46567.1"
FT                   /translation="MIIGVPKEIKNNENRVALTPAGVIPFVTAGHKVLVETNAGVGSGF
FT                   RNVDYVYAGAEIVESAAEVWNQSEMIMKVKEPLESEYIHFRPNLILFTYLHLAAESNLA
FT                   QALKDKRVTAIAYETVEVNHTRPLLTPMSEVAGRMSVQIGAQFLQKSNGGQGILLAGVP
FT                   GVNRGKIAIIGGGIVGTNAAKMAIGLGADVTIIDLNADRLRQLDDIFGTQIKTLMSNPF
FT                   NIAEAVKQADLLISAVLIPGAKAPKLVTEEMVQRMKPGSVIVDVAIDQGGAVETCDHVT
FT                   THDNPTFEKYEVLHYSVANMPGAVPRTSTIALTNVTIPYALQIANKGVQTAIFENDALK
FT                   LGVNTLNGEITCEVVAKELGYKYVSIEEAFAKRIVSN"
     MIIGVPKEIK NNENRVALTP AGVIPFVTAG HKVLVETNAG VGSGFRNVDY VYAGAEIVES        60
     AAEVWNQSEM IMKVKEPLES EYIHFRPNLI LFTYLHLAAE SNLAQALKDK RVTAIAYETV       120
     EVNHTRPLLT PMSEVAGRMS VQIGAQFLQK SNGGQGILLA GVPGVNRGKI AIIGGGIVGT       180
     NAAKMAIGLG ADVTIIDLNA DRLRQLDDIF GTQIKTLMSN PFNIAEAVKQ ADLLISAVLI       240
     PGAKAPKLVT EEMVQRMKPG SVIVDVAIDQ GGAVETCDHV TTHDNPTFEK YEVLHYSVAN       300
     MPGAVPRTST IALTNVTIPY ALQIANKGVQ TAIFENDALK LGVNTLNGEI TCEVVAKELG       360
     YKYVSIEEAF AKRIVSN                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page