(data stored in ACNUC9435 zone)

EMBL: CP000904.PE144

CP000904.PE144       Location/Qualifiers
FT   CDS             complement(194641..195873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5594"
FT                   /product="putative transcriptional regulator, PucR family"
FT                   /note="KEGG: gtn:GTNG_3380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5594"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46568"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ7"
FT                   /protein_id="ABY46568.1"
FT                   /translation="MTYMKNDSFRVTFDSLDEFADIVSEILQCPITIEDVNHRLLAYST
FT                   HDERTDPARIGTIMGRRVPEKVINNLWKEGIIPDLLKNREPIRVKKRDDIGLGDRVAIS
FT                   IWNKEDVLGFIWALEIEKSLTEQDCLLLKKYAEVVKSKLLQLQARKNQKEERSQEFFWK
FT                   LLTNHMQVNTEIMENFYLLQITPASLFTVSVFRFEQGITNEKEKQISYLLKTSQHLKVL
FT                   LYTIDRNQLILLTSLDNVKRPFHEINNFIEMFVHNMEKRYGIKSIKPAFSSVYSDYQKI
FT                   SKAYKETLTVLSIKEKFPSDTTNIHSYQNLGIYQLIDLLLEQRKDEEYENQALQKLDEY
FT                   DHKHNCNLIETLEVYLNKDSNVGEVAKALNIHANTLSYRLKRIYEISEIDLKDPNQKMI
FT                   LYLDLKLKKFM"
     MTYMKNDSFR VTFDSLDEFA DIVSEILQCP ITIEDVNHRL LAYSTHDERT DPARIGTIMG        60
     RRVPEKVINN LWKEGIIPDL LKNREPIRVK KRDDIGLGDR VAISIWNKED VLGFIWALEI       120
     EKSLTEQDCL LLKKYAEVVK SKLLQLQARK NQKEERSQEF FWKLLTNHMQ VNTEIMENFY       180
     LLQITPASLF TVSVFRFEQG ITNEKEKQIS YLLKTSQHLK VLLYTIDRNQ LILLTSLDNV       240
     KRPFHEINNF IEMFVHNMEK RYGIKSIKPA FSSVYSDYQK ISKAYKETLT VLSIKEKFPS       300
     DTTNIHSYQN LGIYQLIDLL LEQRKDEEYE NQALQKLDEY DHKHNCNLIE TLEVYLNKDS       360
     NVGEVAKALN IHANTLSYRL KRIYEISEID LKDPNQKMIL YLDLKLKKFM                  410
//

If you have problems or comments...

PBIL Back to PBIL home page