(data stored in ACNUC9435 zone)

EMBL: CP000904.PE146

CP000904.PE146       Location/Qualifiers
FT   CDS             complement(198396..198992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5597"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_5935
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5597"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46570"
FT                   /db_xref="GOA:A9VUJ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUJ9"
FT                   /protein_id="ABY46570.1"
FT                   /translation="MNKRGRPREFDYSSIVDVAMKTFWIRGYEGCSTQDLCSDTGLGKG
FT                   SLYNTFGSKHELYKQVLERYHEIGIREQKKLLDTPIPVKERLSNFFEWALKEDLENIDQ
FT                   KGCLLINASVERAKNDLMVQEIFSKHVELLKQAIETVMEEGLQTGEISKKQSAEELASL
FT                   LLSSYYGFRVLNVSMQNRMLAEQVIKGTMESIFGA"
     MNKRGRPREF DYSSIVDVAM KTFWIRGYEG CSTQDLCSDT GLGKGSLYNT FGSKHELYKQ        60
     VLERYHEIGI REQKKLLDTP IPVKERLSNF FEWALKEDLE NIDQKGCLLI NASVERAKND       120
     LMVQEIFSKH VELLKQAIET VMEEGLQTGE ISKKQSAEEL ASLLLSSYYG FRVLNVSMQN       180
     RMLAEQVIKG TMESIFGA                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page