(data stored in ACNUC9435 zone)

EMBL: CP000904.PE15

CP000904.PE15        Location/Qualifiers
FT   CDS             32621..33568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5447"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46439"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV07"
FT                   /protein_id="ABY46439.1"
FT                   /translation="MPTPIYIEQHYSLSVSEFEGLWEMTFMHPYNRQEHFSIYLVAPNS
FT                   DYEHAELDDRPIVEAGPRLTEVLKRLLYKIEYYPYSWDFAGKKIVSYGYDFETDFTGTS
FT                   LTYIDLTEIALKEVNEFYNFFSALKTDVVDETEKVSGKGVMAKLKITLDKPKTVNHLFI
FT                   DFFTEYPIELLSLMYQVDQNEESTTYEIPLSKAVQTNGSIYLHFSPVFAKTFYLIIKQE
FT                   SYTLLDQSKKEEEVMKAELWDQASTRSQSIYESAVGEYVDQLFSSKSGIQLHQEILDSY
FT                   QNINVSHASISSDPMNLYRSDFEQAKRSLDSQQR"
     MPTPIYIEQH YSLSVSEFEG LWEMTFMHPY NRQEHFSIYL VAPNSDYEHA ELDDRPIVEA        60
     GPRLTEVLKR LLYKIEYYPY SWDFAGKKIV SYGYDFETDF TGTSLTYIDL TEIALKEVNE       120
     FYNFFSALKT DVVDETEKVS GKGVMAKLKI TLDKPKTVNH LFIDFFTEYP IELLSLMYQV       180
     DQNEESTTYE IPLSKAVQTN GSIYLHFSPV FAKTFYLIIK QESYTLLDQS KKEEEVMKAE       240
     LWDQASTRSQ SIYESAVGEY VDQLFSSKSG IQLHQEILDS YQNINVSHAS ISSDPMNLYR       300
     SDFEQAKRSL DSQQR                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page