(data stored in ACNUC9435 zone)

EMBL: CP000904.PE150

CP000904.PE150       Location/Qualifiers
FT   CDS             complement(204806..206035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5603"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: btk:BT9727_2894 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5603"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46574"
FT                   /db_xref="GOA:A9VUK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK3"
FT                   /protein_id="ABY46574.1"
FT                   /translation="MNNSIDIQHLCDLAHKAFNVPVHILSTDKKILYHSTSDDVCSPFY
FT                   SSKDEHLSDIYQENDPNNLPLFRCNSYLENFVLIHIANHDYIKGTIIIGPTIHPKGSDD
FT                   ITFKLRKEFNLNNNIQERLAYYQCLPEIKKTTLIDMGVLLHYMIFNEKLDVDIVLEKNK
FT                   VLEEVPYKIVKPDLYILKRQQNKPKTHNMALVHNYFSAIKEGDKKKLLQYMYAVSQEDV
FT                   ELILTADPLRNQKNHGIIAITLATRYAIEGNLPPDIAFALSILYIQTMEQLDNVDSVRR
FT                   LSGDALRTFADRVKEFNAQKFSNAVTTCMNHINKNVYDGISLNELANHLDITPTYLSKL
FT                   FKKEVGIPLSDYIQRVRVEEAKKLLTLTTYPLSDICAWLNFNDQSYFTRVFKKSTNMTP
FT                   RQYREKYTVI"
     MNNSIDIQHL CDLAHKAFNV PVHILSTDKK ILYHSTSDDV CSPFYSSKDE HLSDIYQEND        60
     PNNLPLFRCN SYLENFVLIH IANHDYIKGT IIIGPTIHPK GSDDITFKLR KEFNLNNNIQ       120
     ERLAYYQCLP EIKKTTLIDM GVLLHYMIFN EKLDVDIVLE KNKVLEEVPY KIVKPDLYIL       180
     KRQQNKPKTH NMALVHNYFS AIKEGDKKKL LQYMYAVSQE DVELILTADP LRNQKNHGII       240
     AITLATRYAI EGNLPPDIAF ALSILYIQTM EQLDNVDSVR RLSGDALRTF ADRVKEFNAQ       300
     KFSNAVTTCM NHINKNVYDG ISLNELANHL DITPTYLSKL FKKEVGIPLS DYIQRVRVEE       360
     AKKLLTLTTY PLSDICAWLN FNDQSYFTRV FKKSTNMTPR QYREKYTVI                   409
//

If you have problems or comments...

PBIL Back to PBIL home page