(data stored in ACNUC9435 zone)

EMBL: CP000904.PE151

CP000904.PE151       Location/Qualifiers
FT   CDS             complement(207859..209031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5606"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bcz:pE33L466_0056 integrase-recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5606"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46575"
FT                   /db_xref="GOA:A9VUK4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK4"
FT                   /protein_id="ABY46575.1"
FT                   /translation="MDKQNEKENLLIINNQSENIDTYVENIRDMVPFLHNNRYVDKVEE
FT                   KMEVAEKEGKSKYTYLSDLEVIYHFIHLQKDMDENKNRKEDTKKSYVSEILSFCQCMVQ
FT                   HAEEFELNGEEVQQNTSLLKTLQPWHIRKYNSWLKQVENGRNGDTYAVATLAKKTVLIR
FT                   SFLKHLHVFAYIEKPLHEELQRANVNEQDRPNRDLSYDEVMKILGFYKERGHLVNYTIL
FT                   LALASTGARIQELCTTRVKDLHYDGKYWLKVTGKGDKVRELFISEHLYQCICEMRRRRG
FT                   FQTVLDRGDESPLFVNQRGNFYNSKTLSNQVTDMIKKTNLEFLQYRENPVTAHTFRHAF
FT                   AIMAVEQGNADLYHLMQTLGHENIQTTKIYLEKHMKRKNNVGTSFADLLV"
     MDKQNEKENL LIINNQSENI DTYVENIRDM VPFLHNNRYV DKVEEKMEVA EKEGKSKYTY        60
     LSDLEVIYHF IHLQKDMDEN KNRKEDTKKS YVSEILSFCQ CMVQHAEEFE LNGEEVQQNT       120
     SLLKTLQPWH IRKYNSWLKQ VENGRNGDTY AVATLAKKTV LIRSFLKHLH VFAYIEKPLH       180
     EELQRANVNE QDRPNRDLSY DEVMKILGFY KERGHLVNYT ILLALASTGA RIQELCTTRV       240
     KDLHYDGKYW LKVTGKGDKV RELFISEHLY QCICEMRRRR GFQTVLDRGD ESPLFVNQRG       300
     NFYNSKTLSN QVTDMIKKTN LEFLQYRENP VTAHTFRHAF AIMAVEQGNA DLYHLMQTLG       360
     HENIQTTKIY LEKHMKRKNN VGTSFADLLV                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page