(data stored in ACNUC9435 zone)

EMBL: CP000904.PE152

CP000904.PE152       Location/Qualifiers
FT   CDS             209435..210436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5607"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG:
FT                   bcz:pE33L466_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5607"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46576"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK5"
FT                   /protein_id="ABY46576.1"
FT                   /translation="MTQDLLFITKPTVTTKEAAGLLGVTVQTILQKEKDGLIECVYKDN
FT                   WKQFGSKIFYLEDIERIKNIEEVEGYSTKEAAEILNVATSTVFTYIKSGKLPASKIEKR
FT                   GKEVYIIDKDDLETFQLTYEKTTSKERKTFITKIQEEDIYLYQLLTHQHTGKTARVIEI
FT                   NGADGKILTEDEEIFPLSTYKEHDYSFEPFHKQAVITKRGYLSFSLKKPQLFNSIIYNL
FT                   INLFYKELGVTNMRLSISSDTIKLEIKPFVLQVDPLQFQEEIKYLHSHMKSGTILPHVE
FT                   GIYFKSNVEPLTFHADHEFKQKVVQMAADAGMGQEEFLLQAVKFYITNLEKA"
     MTQDLLFITK PTVTTKEAAG LLGVTVQTIL QKEKDGLIEC VYKDNWKQFG SKIFYLEDIE        60
     RIKNIEEVEG YSTKEAAEIL NVATSTVFTY IKSGKLPASK IEKRGKEVYI IDKDDLETFQ       120
     LTYEKTTSKE RKTFITKIQE EDIYLYQLLT HQHTGKTARV IEINGADGKI LTEDEEIFPL       180
     STYKEHDYSF EPFHKQAVIT KRGYLSFSLK KPQLFNSIIY NLINLFYKEL GVTNMRLSIS       240
     SDTIKLEIKP FVLQVDPLQF QEEIKYLHSH MKSGTILPHV EGIYFKSNVE PLTFHADHEF       300
     KQKVVQMAAD AGMGQEEFLL QAVKFYITNL EKA                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page