(data stored in ACNUC9435 zone)

EMBL: CP000904.PE154

CP000904.PE154       Location/Qualifiers
FT   CDS             complement(212314..213072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5609"
FT                   /product="protein of unknown function DUF975"
FT                   /note="PFAM: protein of unknown function DUF975; KEGG:
FT                   bat:BAS2476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5609"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46578"
FT                   /db_xref="GOA:A9VUK7"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK7"
FT                   /protein_id="ABY46578.1"
FT                   /translation="MTRNLKKAALNSLDGKWGGGIGGSALNYFVPTLSASAIATFMYLI
FT                   VGLFIGLIGLDVIFVYSISGQPQVDPTALVLLILSYIFLGLICFLIYSSIQGIFNYGYS
FT                   AFTLHLGKNEDAKVDDVFLGFKKSNLFRSIKLGLLQAIFLFLWSLLLIVPGIIKYFSYS
FT                   MSYYILVENPDYTASEALRESKRIMKGQKLKLFVLWLSFIGWFLLAVFIGMFTFNLSFI
FT                   FISPYYNTTVSHFYLDLIKKQDAGEAKVSI"
     MTRNLKKAAL NSLDGKWGGG IGGSALNYFV PTLSASAIAT FMYLIVGLFI GLIGLDVIFV        60
     YSISGQPQVD PTALVLLILS YIFLGLICFL IYSSIQGIFN YGYSAFTLHL GKNEDAKVDD       120
     VFLGFKKSNL FRSIKLGLLQ AIFLFLWSLL LIVPGIIKYF SYSMSYYILV ENPDYTASEA       180
     LRESKRIMKG QKLKLFVLWL SFIGWFLLAV FIGMFTFNLS FIFISPYYNT TVSHFYLDLI       240
     KKQDAGEAKV SI                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page