(data stored in ACNUC9435 zone)

EMBL: CP000904.PE155

CP000904.PE155       Location/Qualifiers
FT   CDS             213825..214136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5611"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: btk:BT9727_4158
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5611"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46579"
FT                   /db_xref="GOA:A9VUK8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUK8"
FT                   /protein_id="ABY46579.1"
FT                   /translation="MNCNDKVMHILENLRPCFQGLGDPTRQQIVSLLIDKDSLNVTQIA
FT                   EHIPMSRPTVSHHLKILKQSGLLQVQKKGTEMYYCLEFNETINLLKELVSLVEDECKN"
     MNCNDKVMHI LENLRPCFQG LGDPTRQQIV SLLIDKDSLN VTQIAEHIPM SRPTVSHHLK        60
     ILKQSGLLQV QKKGTEMYYC LEFNETINLL KELVSLVEDE CKN                         103
//

If you have problems or comments...

PBIL Back to PBIL home page