(data stored in ACNUC9435 zone)

EMBL: CP000904.PE157

CP000904.PE157       Location/Qualifiers
FT   CDS             215957..217294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5613"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   Berberine/berberine domain protein; KEGG: bay:RBAM_005580
FT                   YvdP"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5613"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46581"
FT                   /db_xref="GOA:A9VUL0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL0"
FT                   /protein_id="ABY46581.1"
FT                   /translation="MGSTKLTGRVIFKGDPGYKEAIKNWNPYVNVFPLVFVFAQNACDV
FT                   SNAIKWARKNCVPLRVRSGRHALDKEFSVVKGGLVIDTSDMNKVHLDKKKGIATVQPGI
FT                   RVGPLVKKLAQEGFMAVFGDSPTVGIGGITTGGGFGVLSRSIGLISDNLLELEMVDAKG
FT                   KIHRANSSHNEDLFWASRGGGGGTFGYNTEYTFKVHPAPKTATVFNIVWPWEQLETVFK
FT                   AWQNLMPFVDERLGCILEILSKVNGLCHATGLFLGSTSELKQILAPLLCAGTPTEIVIK
FT                   TLSYPECIDFLDPPEPPFADQNFKFSSSWSNNLWTEKPIAVMKQFLEKAPGTESEFYFQ
FT                   NWGGAIRNVPKDETAFYWRTPLFYTEWNATWVDPSEEASSLASVEKVRKLLKPYTVGSY
FT                   VNVPDESIKHFGNAYWRSNFKRLQKVKTKYDPENVFHHPQSIPPFC"
     MGSTKLTGRV IFKGDPGYKE AIKNWNPYVN VFPLVFVFAQ NACDVSNAIK WARKNCVPLR        60
     VRSGRHALDK EFSVVKGGLV IDTSDMNKVH LDKKKGIATV QPGIRVGPLV KKLAQEGFMA       120
     VFGDSPTVGI GGITTGGGFG VLSRSIGLIS DNLLELEMVD AKGKIHRANS SHNEDLFWAS       180
     RGGGGGTFGY NTEYTFKVHP APKTATVFNI VWPWEQLETV FKAWQNLMPF VDERLGCILE       240
     ILSKVNGLCH ATGLFLGSTS ELKQILAPLL CAGTPTEIVI KTLSYPECID FLDPPEPPFA       300
     DQNFKFSSSW SNNLWTEKPI AVMKQFLEKA PGTESEFYFQ NWGGAIRNVP KDETAFYWRT       360
     PLFYTEWNAT WVDPSEEASS LASVEKVRKL LKPYTVGSYV NVPDESIKHF GNAYWRSNFK       420
     RLQKVKTKYD PENVFHHPQS IPPFC                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page