(data stored in ACNUC9435 zone)

EMBL: CP000904.PE159

CP000904.PE159       Location/Qualifiers
FT   CDS             complement(218356..219078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5615"
FT                   /product="Oleoyl-(acyl-carrier-protein) hydrolase"
FT                   /EC_number="3.1.2.14"
FT                   /note="PFAM: Thioesterase; KEGG: bce:BC2458 thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5615"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46583"
FT                   /db_xref="GOA:A9VUL2"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL2"
FT                   /protein_id="ABY46583.1"
FT                   /translation="MQKTKLFCFPHAGGSAFSYAKWKNYFNPYIEVVPIELAGRGYRIE
FT                   ESLYQSMEEAVNDVYTSIVKQIEHSPYILYGHSMGSLIAYEVARKIQDSKNVLPEFLVL
FT                   SGRNHPNSKMKNIRHNLSNEQFKREVIAMGGTPSGVLQSEELMGIFLPILRADFKIVET
FT                   YIHDNNMQACDIDFLIFNGENDEFTTYNQVIKWEQYTSKTCTFHSFKGNHFFLNENIEE
FT                   IANRIIRKLDSKRFSTSF"
     MQKTKLFCFP HAGGSAFSYA KWKNYFNPYI EVVPIELAGR GYRIEESLYQ SMEEAVNDVY        60
     TSIVKQIEHS PYILYGHSMG SLIAYEVARK IQDSKNVLPE FLVLSGRNHP NSKMKNIRHN       120
     LSNEQFKREV IAMGGTPSGV LQSEELMGIF LPILRADFKI VETYIHDNNM QACDIDFLIF       180
     NGENDEFTTY NQVIKWEQYT SKTCTFHSFK GNHFFLNENI EEIANRIIRK LDSKRFSTSF       240
//

If you have problems or comments...

PBIL Back to PBIL home page