(data stored in ACNUC9435 zone)

EMBL: CP000904.PE16

CP000904.PE16        Location/Qualifiers
FT   CDS             33583..34797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5448"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46440"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV08"
FT                   /protein_id="ABY46440.1"
FT                   /translation="MVNSFESASKPKTTLLQSQSATSSTTPGPLPPIVEGIGSSNRTNS
FT                   STEYVYQYGIKNLQLNHSLYEQAGIFVTKPIEVEGNIVEVSLSIFEDHPLFNELNGMAT
FT                   DRVTSIEYYISLEENPSLNDWVSILPEGTRNVRCEKLFFRGSSAELRFHADISDEDNTR
FT                   VYRNNILMNRSDWYFTERGAAIQLTVPHDNSSIYTIDYVPNANLFDPWTVKVGDRFSKR
FT                   VRKVESFPNGTDYNNTIKLSKYPYVDYKQVNSEESYDPNTSDYRPIDVFLTSGSIVVEG
FT                   GKTQQEFFPISYSSKNEFTTKNRTDYKTNKDVFLNKYSIVPDSVYNTFEYKQEKNKLIF
FT                   TESFNRSDLYYNEATNHGNATVVVHYDYLVTNFRLKVILRKNVGDELVVTPMVDSYQLK
FT                   FKVMK"
     MVNSFESASK PKTTLLQSQS ATSSTTPGPL PPIVEGIGSS NRTNSSTEYV YQYGIKNLQL        60
     NHSLYEQAGI FVTKPIEVEG NIVEVSLSIF EDHPLFNELN GMATDRVTSI EYYISLEENP       120
     SLNDWVSILP EGTRNVRCEK LFFRGSSAEL RFHADISDED NTRVYRNNIL MNRSDWYFTE       180
     RGAAIQLTVP HDNSSIYTID YVPNANLFDP WTVKVGDRFS KRVRKVESFP NGTDYNNTIK       240
     LSKYPYVDYK QVNSEESYDP NTSDYRPIDV FLTSGSIVVE GGKTQQEFFP ISYSSKNEFT       300
     TKNRTDYKTN KDVFLNKYSI VPDSVYNTFE YKQEKNKLIF TESFNRSDLY YNEATNHGNA       360
     TVVVHYDYLV TNFRLKVILR KNVGDELVVT PMVDSYQLKF KVMK                        404
//

If you have problems or comments...

PBIL Back to PBIL home page