(data stored in ACNUC9435 zone)

EMBL: CP000904.PE161

CP000904.PE161       Location/Qualifiers
FT   CDS             complement(220192..235098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5617"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: non-ribosomal peptide synthase; amino acid
FT                   adenylation domain; PFAM: AMP-dependent synthetase and
FT                   ligase; Thioesterase; condensation domain protein;
FT                   phosphopantetheine-binding; KEGG: bce:BC2456 peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5617"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46585"
FT                   /db_xref="GOA:A9VUL4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL4"
FT                   /protein_id="ABY46585.1"
FT                   /translation="MRSDLHAKLSSLSPEKRAWLQKRMQKKENKEALPLSYAQQRLWFM
FT                   DRFNPNSSLYNIPTVWHLKGNWIPEALEKGFNRLIERHESLRTVFKEVGEQPVQQIVEF
FT                   LPRALPVRDYSQLPLEVKEKEVDSLIAREAQEPFDLMNGPLIRNQLVQLGKDEWLLLCT
FT                   MHHIISDAWSIGILMNELLTFYEEETGGNPAKLSSLSIQYADFAKWQKEWLQGDVLNRQ
FT                   LTYWEEELSGELPILQLPVDRPRPVTQTYAGDTHHVIFPYRLLNQLKDISRQEGSTLFM
FT                   TLMAAYQSFLARYTGQKDILVGSPIANRNHKGVEGLIGFFVNTLVYRSDLSGTPTFREI
FT                   LNQTKKKALKAYEYQDIPFEKVVEAVQPERSMSHSPIFQTMFTLQNIKQERLDLSGRSI
FT                   EMVESNMSIVKFDLSLTAYEVEEGLFVSFEYNTDLFDSSTVARMAGHFENWLNEIAYHP
FT                   DESYTKLSMLSDTEQKQLLEEWNDTDVVYGHEYMIHELFEQQVARTPDAVAVVYEGGKL
FT                   TYQELNEKSNQLAHYLQKRGIGPESLVGICVERSPEMIIGLFGILKAGGAYVPLDPSYP
FT                   ENRLRYILENSQIQVLLTKEALQDWLPKDIQAICLDRDQVMISKESNLAPVSGVTANNL
FT                   AYIIYTSGSTGNPKGVMIEHHSVINRLQWMQKKYPLSEEDTILQKTPFSFDVSVWELFW
FT                   WSFVGARVCLLQPGGEKDPAVIEEYIERYRVTTMHFVPSMLSTFLDYMEQYNSKRDESS
FT                   LNQVFTSGEALNTEQVRRFKGVFYDVQQTKLINLYGPTEATVDVTYYDCDLEKEPMLIP
FT                   IGRPIDNTELYVLDQYQQVVPIGVAGELYLGGVGLARGYFNRPELTTERFIPHPFKEGE
FT                   RLYRTGDLVRYMNDRNLEYIGRIDNQVKIRGFRIELGEIEAALHDHSSVKEAVVLVKED
FT                   RPGDKQLVAYVVGEGDTGEWREYLKKQLPNYMVPAYFFQVESMPLTPNGKVDRKALLEL
FT                   EAQFISEDITSSRTPVEELIVSVWSKVLGIRNISVQDSFFEIGGHSLLATQVVSRLQEI
FT                   FQIELPVRELFEYATVESLAKRLDQLRKGDRKRDIPPLMPMERGETIPLSYAQQRLWFI
FT                   DQFTPNSALYNMPIVCRLTGSWLPEALETGWNQLIERHESLRTVFHEVNGQPVQQIEPY
FT                   AFRLIPKTDLTMLSPEGREEEVKRLIQQETEMPFDLGEGPLIRTSILQVGEEEWILLCT
FT                   LHHIISDGWSMEVLLEEWMAFYEKATDGKIAELEPLPVQYADFAQWQKGWLKAEVLDQQ
FT                   LQYWKEELSGELPVLQLPMDRPRPAIQTHDGSTYTLVLPSALHDKLNEFSLQEGATLFM
FT                   TLLAAYQSFLSRYTGQEDILVGSPIANRNYREIEGLIGFFVNTLVYRANLSGRPTFQDV
FT                   LSQVRQKALKAYEYQDIPFEKIVEVVQPERSTSHSPIFQTMFILQNLKQEFPVLSGRSI
FT                   EMIESHSPIAKFDLSVMVAETEEGVRFTFEYNKDLFNATTIERMAGHFEKWLHEVSHHP
FT                   KNPLHSLSMLSEPERTLLLETWNDTVMEMPPQGLICDRFEEQVAKRPEAIAVVDQTKDW
FT                   TYGELDAQANQLANVLQRKGVAPESVVGVYLPRSAELMVSLLGILKAGGAYVVLDPLYP
FT                   KSRLEYMIEDAGIQFVVTAEGQEGLFEQVEMVRLEELTVESVIAPTRQINPENLAYIVY
FT                   TSGSTGKPKGVMIEYRSLMNMVSWHHEVYRITAEDRATQIAGIAFDSAVQEIWPYLTAG
FT                   AALYLSTEELRINPEALRDWLIDSRITASFAPTPILERLLKLSWPDKTDLRFIITGGDQ
FT                   LTQYPSNDIPFAVINQYGPSENTVVTTDCYVPVGVTTGTPSIGRPIANTEVYVLDSHLQ
FT                   LVPSGVIGDLYIGGKSLARGYANRPDLTKEKFISHPFKSGERLYYTGDKASYLSDGALQ
FT                   FHGRIDDQVKIRGFRIELGEIEAVLQAHSSVKEAVVLVREDDPGDKRLVAYVVGEGSVQ
FT                   EWREHLQTHLPNYMVPTNFIEMEFLPLTPNGKLDLKALPIPSKLSTENTVHARTPLEEL
FT                   IASVWSQVLGIENIGVQDSFFELGGHSLLATQVVSRLQEVFQIKLPVRELFEYSTVEAL
FT                   AKRLDQLRKGGKKREIPPLMPMERGNAIPLSYAQQRLWFIDQFTPNSALYNMPMVCRLT
FT                   GNWLLEALEVGWNQLIERHESLRTVFHEVDGHPVQKIQPYTFRSLPQIDLTKISPEERE
FT                   REVEQWIQTEVESPFDLEQGPLFRGQIVKISEEEWVLLCNMHHIISDGWSMEILLQEWM
FT                   AFYEEAIGEKPADLAPLPVQYADFAQWQREWLIDEVLNQPLAYWKEELSGELPVLMLPM
FT                   DRPRPPVQTHHGLTHNVLLSRSLLDKLNELSRQEGATLFMTLLASYQSFLARYTGQSDI
FT                   LVGSPIANRNYREIEGLIGFFVNTLVYRADLSGAPAFQELLSQVRIKALKAYEYQDVPF
FT                   EKIVEVIQPERSTSYSPIFQTMFTLQNTGQELPKLHGRSIEVMDSHASIAKFDLSLTAA
FT                   EVEEGLLLTFVYRTDLFDSLTIESIAENFGNWLNLIVEQPDKSLAKLPILSGLQQKQLE
FT                   EWNNNAVAYPQEFGIHQLYEEQVNRTPDAVAVVDEKQQLTYRELNEKANQLAHYLQKCG
FT                   IGSESLVGLCFQRSAEMIVGLMGILKAGAAYVPLDPSYPESRLRYILEDTGIQVLVTNE
FT                   ALEGWITEEIKTVCLDRDKAMISRESTLSPICEVTGENLAYVIYTSGSTGNPKGVMVEH
FT                   HNVIRLFKSTECWYQFDEKDTWTLFHSYAFDFSVWEIWGALLHGGRLIVVPYWISRSPK
FT                   DFYQLLVKEKVTVLNQTPSAFRQLIQVCEQEDEKKDLHLRYVIFGGEALDPTSLVPWFQ
FT                   RYGGQEPQLINMYGITETTVHVTYYPITQDDVQHASRSNIGKQIPDLEVYVLDACQQPV
FT                   PIGVAGELFIGGAGLARGYLNRSELTAERFIPHPFSSDPGARLYRTGDLARYLPDGNLD
FT                   YLGRIDHQVKIRGFRIELGEIESALNAHVSIKEAVVIVREDQPGDKRLVAYVVGDGNVG
FT                   EWRDYLKAELPSHMVPSGFVMMEAIPLTANGKVDRKALPVPEERKIESECVATRNGNEE
FT                   TLATIWKQVLGIKKVGIHDNFFEIGGDSILSIQIVSRAKQAGLQLTPKQMFEHQTIAEL
FT                   AQVVNEERGVQAEQGVITGELILTPIQQWFFAQDHPNPHHWNQSMFFRTKERLDIVLLE
FT                   KAVRTLLIHHDALRLRYERLPNGAWKQWNEGIEEQSTLTVISLDEVPQAEWHQVIQAEI
FT                   DTAQASLHLHAGPLMRMVYFDEGEKRAGRLFWVIHHLAVDGVSWRILLEDLQTAYNQAS
FT                   QDQMIQLPTKSTSFKAWSEKLHHYAEAGIVQEVRDYWEQQSEQEVAMLPVDTTLEVPAN
FT                   TGTEEITVVLDEKETRTLLKEISSTHRVQINEVLLTALVQATAVWTGHPALTVDLEGHG
FT                   REEIIEDVDLSRTVGWFTSIYPVHLNITGADTPIAALKAVKEQVRKIPNKGVDHGILRY
FT                   LNTTICEQWGSQHTPSISFNYLGQFDQMFSDDAILIPENGFKRLDHASGSKRSHLIDVI
FT                   GMVTDGKLQFTWVYNVGQYAKSTIQSIAENMLHQLSKLIQSAGGESALTVSDFVMANLD
FT                   QASLTKVLTKMNRGNNYPITDLYPLSPLQEGMIFHTLHDQGEEHVAPYIVQLSFMIRGE
FT                   LDIATFEQAWKSVIQRHEIFRSAFLWDEVEEPLQVVYESVPFKVNVEDWRTLTAEEKEE
FT                   KRKAFLALDRKQAFLFDKAPLMRVTVIQEGEEEYRIVWTHHHILLDGWSLPLVFNELLT
FT                   VYQKRMNGEAVHLPNSSPYKKYIQWLREQNQEQAEQFWREKLKGFTAPTLLGLESKEQE
FT                   KGYTEKVTYLSEEQTQALQNWAKRNRLTLNTVIQGAWAYLMSRYSGEDEIVYGVTSSGR
FT                   PTEIIDVENIVGPFITTSPTRIQLIDNIKVMDWLLKIQEEEIERRQYEYASLTEIQGWS
FT                   EIPRGTPLFHSLYVFENYPVKEGSSGNLEIGELEGVEQTHYPLGLTVVPESQLLLKLKY
FT                   DRSKFNGLTIERMLGHLSQVLKQMIENVDQTLSELVYVTEIEQKQLLEEWNDNAAAYPR
FT                   ESVIHKLFEDQVDRTPDAVAVVDENQRLTYRELNEKANQLAHYLQKMGIGTESLVGLCF
FT                   QRSVEMIVGLMGILKAGSAYVPLDPSYPESHLRYILEDTGIQILVTNEVSQGWMPEEVE
FT                   TVCLDRDQAMISQENTLSPICKVTGENLAYVIYTSGSTGNPKGVMVQHHSVLNLSYGLQ
FT                   KEVFSHRAHDNMRVGLNASIAFDSSVKQLQMLLYGSSLYIISTEVRSDPQQFISYIREN
FT                   KLEMFDITPSLLQLLIDEGLLETNDSVHVPSKVLVGGEAIMPSLWEQLVENDHIHFYNV
FT                   YGPTECTVDATCYRIKKDSKRVTIGRPLPNVQAYVLDEKLLPVPVGVTGELYIGGAGLA
FT                   RGYLNRPELTLERFIPHPFNEGERLYRTGDLVRYLADGHLDYLGRIDNQVKIRGFRIEL
FT                   GEIEANLESHPSVKEAVVLIREDQPGDQRLVAYVVGEGSMHEWREHLKRQVPNHMIPAH
FT                   FIEVDAIPLTTNGKVDRKALNSLTIQRENTFSTPIIPRDEIEYQLITIWQDLLQLEDIH
FT                   VNDDFFNIGGHSLLVIKLISKVREKFGKEIKVPALIKNPTVEGIACLIRENHRMEESLS
FT                   VLVPLQESEKRPFFCVHPFMGNVLCYIQLARLLKDHCSFYGLQNPLVEKEGMNGLILSE
FT                   VVQLYIEEMKRAQPEGPYRLGGWSLGGAIAYEIATMLRNQGEEVEVLVLLDTKVPSERD
FT                   YKTEDDMLSYILEHFIHIELVDQEEELVHQQDMLVEQLIVEGVLPPDANLTNLKQLINA
FT                   HRKCLNLMAEHDLTPYFGEVIYFSAEEGKELFTDWKPLLKGRVNMYSVPGSHEEIVASP
FT                   AVEKLAKYLLNELEGIKETSLSLTEK"
     MRSDLHAKLS SLSPEKRAWL QKRMQKKENK EALPLSYAQQ RLWFMDRFNP NSSLYNIPTV        60
     WHLKGNWIPE ALEKGFNRLI ERHESLRTVF KEVGEQPVQQ IVEFLPRALP VRDYSQLPLE       120
     VKEKEVDSLI AREAQEPFDL MNGPLIRNQL VQLGKDEWLL LCTMHHIISD AWSIGILMNE       180
     LLTFYEEETG GNPAKLSSLS IQYADFAKWQ KEWLQGDVLN RQLTYWEEEL SGELPILQLP       240
     VDRPRPVTQT YAGDTHHVIF PYRLLNQLKD ISRQEGSTLF MTLMAAYQSF LARYTGQKDI       300
     LVGSPIANRN HKGVEGLIGF FVNTLVYRSD LSGTPTFREI LNQTKKKALK AYEYQDIPFE       360
     KVVEAVQPER SMSHSPIFQT MFTLQNIKQE RLDLSGRSIE MVESNMSIVK FDLSLTAYEV       420
     EEGLFVSFEY NTDLFDSSTV ARMAGHFENW LNEIAYHPDE SYTKLSMLSD TEQKQLLEEW       480
     NDTDVVYGHE YMIHELFEQQ VARTPDAVAV VYEGGKLTYQ ELNEKSNQLA HYLQKRGIGP       540
     ESLVGICVER SPEMIIGLFG ILKAGGAYVP LDPSYPENRL RYILENSQIQ VLLTKEALQD       600
     WLPKDIQAIC LDRDQVMISK ESNLAPVSGV TANNLAYIIY TSGSTGNPKG VMIEHHSVIN       660
     RLQWMQKKYP LSEEDTILQK TPFSFDVSVW ELFWWSFVGA RVCLLQPGGE KDPAVIEEYI       720
     ERYRVTTMHF VPSMLSTFLD YMEQYNSKRD ESSLNQVFTS GEALNTEQVR RFKGVFYDVQ       780
     QTKLINLYGP TEATVDVTYY DCDLEKEPML IPIGRPIDNT ELYVLDQYQQ VVPIGVAGEL       840
     YLGGVGLARG YFNRPELTTE RFIPHPFKEG ERLYRTGDLV RYMNDRNLEY IGRIDNQVKI       900
     RGFRIELGEI EAALHDHSSV KEAVVLVKED RPGDKQLVAY VVGEGDTGEW REYLKKQLPN       960
     YMVPAYFFQV ESMPLTPNGK VDRKALLELE AQFISEDITS SRTPVEELIV SVWSKVLGIR      1020
     NISVQDSFFE IGGHSLLATQ VVSRLQEIFQ IELPVRELFE YATVESLAKR LDQLRKGDRK      1080
     RDIPPLMPME RGETIPLSYA QQRLWFIDQF TPNSALYNMP IVCRLTGSWL PEALETGWNQ      1140
     LIERHESLRT VFHEVNGQPV QQIEPYAFRL IPKTDLTMLS PEGREEEVKR LIQQETEMPF      1200
     DLGEGPLIRT SILQVGEEEW ILLCTLHHII SDGWSMEVLL EEWMAFYEKA TDGKIAELEP      1260
     LPVQYADFAQ WQKGWLKAEV LDQQLQYWKE ELSGELPVLQ LPMDRPRPAI QTHDGSTYTL      1320
     VLPSALHDKL NEFSLQEGAT LFMTLLAAYQ SFLSRYTGQE DILVGSPIAN RNYREIEGLI      1380
     GFFVNTLVYR ANLSGRPTFQ DVLSQVRQKA LKAYEYQDIP FEKIVEVVQP ERSTSHSPIF      1440
     QTMFILQNLK QEFPVLSGRS IEMIESHSPI AKFDLSVMVA ETEEGVRFTF EYNKDLFNAT      1500
     TIERMAGHFE KWLHEVSHHP KNPLHSLSML SEPERTLLLE TWNDTVMEMP PQGLICDRFE      1560
     EQVAKRPEAI AVVDQTKDWT YGELDAQANQ LANVLQRKGV APESVVGVYL PRSAELMVSL      1620
     LGILKAGGAY VVLDPLYPKS RLEYMIEDAG IQFVVTAEGQ EGLFEQVEMV RLEELTVESV      1680
     IAPTRQINPE NLAYIVYTSG STGKPKGVMI EYRSLMNMVS WHHEVYRITA EDRATQIAGI      1740
     AFDSAVQEIW PYLTAGAALY LSTEELRINP EALRDWLIDS RITASFAPTP ILERLLKLSW      1800
     PDKTDLRFII TGGDQLTQYP SNDIPFAVIN QYGPSENTVV TTDCYVPVGV TTGTPSIGRP      1860
     IANTEVYVLD SHLQLVPSGV IGDLYIGGKS LARGYANRPD LTKEKFISHP FKSGERLYYT      1920
     GDKASYLSDG ALQFHGRIDD QVKIRGFRIE LGEIEAVLQA HSSVKEAVVL VREDDPGDKR      1980
     LVAYVVGEGS VQEWREHLQT HLPNYMVPTN FIEMEFLPLT PNGKLDLKAL PIPSKLSTEN      2040
     TVHARTPLEE LIASVWSQVL GIENIGVQDS FFELGGHSLL ATQVVSRLQE VFQIKLPVRE      2100
     LFEYSTVEAL AKRLDQLRKG GKKREIPPLM PMERGNAIPL SYAQQRLWFI DQFTPNSALY      2160
     NMPMVCRLTG NWLLEALEVG WNQLIERHES LRTVFHEVDG HPVQKIQPYT FRSLPQIDLT      2220
     KISPEERERE VEQWIQTEVE SPFDLEQGPL FRGQIVKISE EEWVLLCNMH HIISDGWSME      2280
     ILLQEWMAFY EEAIGEKPAD LAPLPVQYAD FAQWQREWLI DEVLNQPLAY WKEELSGELP      2340
     VLMLPMDRPR PPVQTHHGLT HNVLLSRSLL DKLNELSRQE GATLFMTLLA SYQSFLARYT      2400
     GQSDILVGSP IANRNYREIE GLIGFFVNTL VYRADLSGAP AFQELLSQVR IKALKAYEYQ      2460
     DVPFEKIVEV IQPERSTSYS PIFQTMFTLQ NTGQELPKLH GRSIEVMDSH ASIAKFDLSL      2520
     TAAEVEEGLL LTFVYRTDLF DSLTIESIAE NFGNWLNLIV EQPDKSLAKL PILSGLQQKQ      2580
     LEEWNNNAVA YPQEFGIHQL YEEQVNRTPD AVAVVDEKQQ LTYRELNEKA NQLAHYLQKC      2640
     GIGSESLVGL CFQRSAEMIV GLMGILKAGA AYVPLDPSYP ESRLRYILED TGIQVLVTNE      2700
     ALEGWITEEI KTVCLDRDKA MISRESTLSP ICEVTGENLA YVIYTSGSTG NPKGVMVEHH      2760
     NVIRLFKSTE CWYQFDEKDT WTLFHSYAFD FSVWEIWGAL LHGGRLIVVP YWISRSPKDF      2820
     YQLLVKEKVT VLNQTPSAFR QLIQVCEQED EKKDLHLRYV IFGGEALDPT SLVPWFQRYG      2880
     GQEPQLINMY GITETTVHVT YYPITQDDVQ HASRSNIGKQ IPDLEVYVLD ACQQPVPIGV      2940
     AGELFIGGAG LARGYLNRSE LTAERFIPHP FSSDPGARLY RTGDLARYLP DGNLDYLGRI      3000
     DHQVKIRGFR IELGEIESAL NAHVSIKEAV VIVREDQPGD KRLVAYVVGD GNVGEWRDYL      3060
     KAELPSHMVP SGFVMMEAIP LTANGKVDRK ALPVPEERKI ESECVATRNG NEETLATIWK      3120
     QVLGIKKVGI HDNFFEIGGD SILSIQIVSR AKQAGLQLTP KQMFEHQTIA ELAQVVNEER      3180
     GVQAEQGVIT GELILTPIQQ WFFAQDHPNP HHWNQSMFFR TKERLDIVLL EKAVRTLLIH      3240
     HDALRLRYER LPNGAWKQWN EGIEEQSTLT VISLDEVPQA EWHQVIQAEI DTAQASLHLH      3300
     AGPLMRMVYF DEGEKRAGRL FWVIHHLAVD GVSWRILLED LQTAYNQASQ DQMIQLPTKS      3360
     TSFKAWSEKL HHYAEAGIVQ EVRDYWEQQS EQEVAMLPVD TTLEVPANTG TEEITVVLDE      3420
     KETRTLLKEI SSTHRVQINE VLLTALVQAT AVWTGHPALT VDLEGHGREE IIEDVDLSRT      3480
     VGWFTSIYPV HLNITGADTP IAALKAVKEQ VRKIPNKGVD HGILRYLNTT ICEQWGSQHT      3540
     PSISFNYLGQ FDQMFSDDAI LIPENGFKRL DHASGSKRSH LIDVIGMVTD GKLQFTWVYN      3600
     VGQYAKSTIQ SIAENMLHQL SKLIQSAGGE SALTVSDFVM ANLDQASLTK VLTKMNRGNN      3660
     YPITDLYPLS PLQEGMIFHT LHDQGEEHVA PYIVQLSFMI RGELDIATFE QAWKSVIQRH      3720
     EIFRSAFLWD EVEEPLQVVY ESVPFKVNVE DWRTLTAEEK EEKRKAFLAL DRKQAFLFDK      3780
     APLMRVTVIQ EGEEEYRIVW THHHILLDGW SLPLVFNELL TVYQKRMNGE AVHLPNSSPY      3840
     KKYIQWLREQ NQEQAEQFWR EKLKGFTAPT LLGLESKEQE KGYTEKVTYL SEEQTQALQN      3900
     WAKRNRLTLN TVIQGAWAYL MSRYSGEDEI VYGVTSSGRP TEIIDVENIV GPFITTSPTR      3960
     IQLIDNIKVM DWLLKIQEEE IERRQYEYAS LTEIQGWSEI PRGTPLFHSL YVFENYPVKE      4020
     GSSGNLEIGE LEGVEQTHYP LGLTVVPESQ LLLKLKYDRS KFNGLTIERM LGHLSQVLKQ      4080
     MIENVDQTLS ELVYVTEIEQ KQLLEEWNDN AAAYPRESVI HKLFEDQVDR TPDAVAVVDE      4140
     NQRLTYRELN EKANQLAHYL QKMGIGTESL VGLCFQRSVE MIVGLMGILK AGSAYVPLDP      4200
     SYPESHLRYI LEDTGIQILV TNEVSQGWMP EEVETVCLDR DQAMISQENT LSPICKVTGE      4260
     NLAYVIYTSG STGNPKGVMV QHHSVLNLSY GLQKEVFSHR AHDNMRVGLN ASIAFDSSVK      4320
     QLQMLLYGSS LYIISTEVRS DPQQFISYIR ENKLEMFDIT PSLLQLLIDE GLLETNDSVH      4380
     VPSKVLVGGE AIMPSLWEQL VENDHIHFYN VYGPTECTVD ATCYRIKKDS KRVTIGRPLP      4440
     NVQAYVLDEK LLPVPVGVTG ELYIGGAGLA RGYLNRPELT LERFIPHPFN EGERLYRTGD      4500
     LVRYLADGHL DYLGRIDNQV KIRGFRIELG EIEANLESHP SVKEAVVLIR EDQPGDQRLV      4560
     AYVVGEGSMH EWREHLKRQV PNHMIPAHFI EVDAIPLTTN GKVDRKALNS LTIQRENTFS      4620
     TPIIPRDEIE YQLITIWQDL LQLEDIHVND DFFNIGGHSL LVIKLISKVR EKFGKEIKVP      4680
     ALIKNPTVEG IACLIRENHR MEESLSVLVP LQESEKRPFF CVHPFMGNVL CYIQLARLLK      4740
     DHCSFYGLQN PLVEKEGMNG LILSEVVQLY IEEMKRAQPE GPYRLGGWSL GGAIAYEIAT      4800
     MLRNQGEEVE VLVLLDTKVP SERDYKTEDD MLSYILEHFI HIELVDQEEE LVHQQDMLVE      4860
     QLIVEGVLPP DANLTNLKQL INAHRKCLNL MAEHDLTPYF GEVIYFSAEE GKELFTDWKP      4920
     LLKGRVNMYS VPGSHEEIVA SPAVEKLAKY LLNELEGIKE TSLSLTEK                   4968
//

If you have problems or comments...

PBIL Back to PBIL home page