(data stored in ACNUC9435 zone)

EMBL: CP000904.PE162

CP000904.PE162       Location/Qualifiers
FT   CDS             complement(235095..241565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5618"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; condensation domain
FT                   protein; phosphopantetheine-binding; KEGG: bce:BC2453
FT                   peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5618"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46586"
FT                   /db_xref="GOA:A9VUL5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUL5"
FT                   /protein_id="ABY46586.1"
FT                   /translation="MGDVIDIYGLSPLQKGILFHTLYDQDDEHSFSYIVQVGFLLGGQL
FT                   DVATFEKAWEYVIHRHEVLRSVFVWEEVEKPLQAVYQRLPFTIHQEDWSAHSHEEREKK
FT                   LHQFLTADRRKGFLLDEAPVMRVTAIKEAEEETRIIWTHHHILLDGWSVSLVFSEVMEV
FT                   YLKMIKGELLNFPKPLPYKKYIQWINKQDQSQAEEFWTEELKGFYAPTPLAMERKDQEQ
FT                   EKGYGECVYQVSEELTENLQEWIRNSRLTLNTLVQGAWAYLMSRYSGESDIVFGVTSSG
FT                   RPTDLIGAENMVGLFINTLPTRIRLTNDTLVVDWLRKIQMKEMERRQYEYNSLVDIQGW
FT                   SEVPRNSSLFHTLYVFENYPIQGERNDDLRLLDVKSAEQTNYPLTLIVMPGKEITLKLM
FT                   YDRSYFNEETINRIQGHLLQTLIQMTKSLDSKLSEITHLTMEEQTQLLEEWNNTQVKYS
FT                   AEGMIHTAFEEQVKKTPGAIAAIYENEQITYRELDERANQLAHYLQKRSVGPESLVGVY
FT                   MERSLQMMIALLGILKSGGAYVPLDPTYPESRLRYILEDAGIEVLVTEENSENLYISED
FT                   VETICMNKDYTAIKKEESIPCISGVTGRSLAYVMYTSGSTGNPKGVMIEHHSVINYLEW
FT                   MQHKYPLSEKDVVLQKTPFSFDVSVWELFWGIHVGASISFLPPGGEKDPTIIAEVIEKH
FT                   QVTIVQFVPSMLSVFLDHLNHIELNMNCSSMRHVFSGGEELSSGLVRRFQQQWNHSGQV
FT                   KLTNFYGPTEATIYVNAFDIQPNQEFVSIGQPIQNTQLYVLDQNQRLQSIGIEGELYIG
FT                   GAGLARGYLNRPNLTAEKFVSHPFRLGEQLYRTGDSVRYLTDGNLEFIGRMDHQVKMRG
FT                   FRIELGEIEATLEKYSFIKEAVVLVREDRPGDQRLVAYVISDGNTQKWREYLQNQLPNH
FT                   MIPAHLVELEQFPLTPNGKIDRKALPAPDEQPMGDFNVLPRTPTEELIASVWSQVLGIE
FT                   NIGIQDSFFEQGGHSLLATQIVSRLQELFQIKIPLRELFKHDTVESLAERVDQLRKEDK
FT                   KREVPPLVPMTREESIPLSYAQKRLWFIDQLMPNNAMYNIHAACRLTGKWSIEALEAGW
FT                   NQLLERHESLRTIILEQEGEPFQQVQSHVFRHIPQTDLTDLSLEDRKREMKRLIQNEAE
FT                   ETFHFGQGPLIRTRILKVDREEWVLLCTMHHIISDGWSMGILLEEWMAFYEGALSEKPP
FT                   ELKELSIQYADFVMWQKEWQKEENLDQHLQYWKEELSGELPVLQLPMDRPRPAVQTHRG
FT                   ASQSLMVANSLQEKLKGLSLQEGSTLFMTLMAAYQSFLSRYSGQDDILVGSPIANRNVK
FT                   EVEGLIGFFANTLVYRADFSGNPTFQELLSQIRKKALKAYEYQDIPFEEVVESVKPERN
FT                   TSHSPIFQTMFTLQNTKQEFPQLSERHMELMESHTSVAKFDLSLFASETEEGLSLTFEY
FT                   NTDLFNDTTIERMASHFEHWLYQIVSHPKDLLSELNMLSKVEYKQLLEEWNETGVVDIR
FT                   ESTIHTLFEEQVEKTPEAIAVVCEDEELTYRELDERSNQLAHYLQKHGVGCESMVGICV
FT                   TRSSEMIVGLLGIMKAGGAYVPIDPAYPESRLQYILEDAHIKVLVTLEKLQQKMVIPKS
FT                   VAVICIDRDREEIEQEVTTVCTSEVTGDNLAYIIYTSGSTGNPKGVMIEHRNTVTMIHW
FT                   AHHTYSQKELAGVLASTSLSFDLSVFEVFVPLTMGGKVIVAENALHLDKLSTKGVTLVN
FT                   TVPSAAKELVRAKTIPSSVKVMNLAGEPLPYSLVQDLYERSTIEKVYNLYGPSEDTTYS
FT                   TYMELEKGVMHRVPPIGKPVFNTEVYVLSAEQKMVPIGVVGELYIGGSGLARGYLNRPD
FT                   LTQDRFIPHPFKEGERVYRTGDLVRYLPDGNLEYLGRIDHQVKIRGFRIELGEIEATLQ
FT                   KHALVNEVLVMVREDYPGDPRLIAYVLGDGDAHKWRDYLKDQLPNYMIPAYFVGLNAFP
FT                   LTSNGKIDRKALPAPERQEIASGYIAPRTPTEKTIVSIWHQVLGVENIGVQDSFFEIGG
FT                   HSLLATQAVSNLKEAFGIELPLHDLFTFHTVQQLAKQIDQLFYNKNQEIQNDSKENVSL
FT                   QDYIQKEAEVSNDEELLELLKQLEELSEEEAQGIFESNLVEEGVKK"
     MGDVIDIYGL SPLQKGILFH TLYDQDDEHS FSYIVQVGFL LGGQLDVATF EKAWEYVIHR        60
     HEVLRSVFVW EEVEKPLQAV YQRLPFTIHQ EDWSAHSHEE REKKLHQFLT ADRRKGFLLD       120
     EAPVMRVTAI KEAEEETRII WTHHHILLDG WSVSLVFSEV MEVYLKMIKG ELLNFPKPLP       180
     YKKYIQWINK QDQSQAEEFW TEELKGFYAP TPLAMERKDQ EQEKGYGECV YQVSEELTEN       240
     LQEWIRNSRL TLNTLVQGAW AYLMSRYSGE SDIVFGVTSS GRPTDLIGAE NMVGLFINTL       300
     PTRIRLTNDT LVVDWLRKIQ MKEMERRQYE YNSLVDIQGW SEVPRNSSLF HTLYVFENYP       360
     IQGERNDDLR LLDVKSAEQT NYPLTLIVMP GKEITLKLMY DRSYFNEETI NRIQGHLLQT       420
     LIQMTKSLDS KLSEITHLTM EEQTQLLEEW NNTQVKYSAE GMIHTAFEEQ VKKTPGAIAA       480
     IYENEQITYR ELDERANQLA HYLQKRSVGP ESLVGVYMER SLQMMIALLG ILKSGGAYVP       540
     LDPTYPESRL RYILEDAGIE VLVTEENSEN LYISEDVETI CMNKDYTAIK KEESIPCISG       600
     VTGRSLAYVM YTSGSTGNPK GVMIEHHSVI NYLEWMQHKY PLSEKDVVLQ KTPFSFDVSV       660
     WELFWGIHVG ASISFLPPGG EKDPTIIAEV IEKHQVTIVQ FVPSMLSVFL DHLNHIELNM       720
     NCSSMRHVFS GGEELSSGLV RRFQQQWNHS GQVKLTNFYG PTEATIYVNA FDIQPNQEFV       780
     SIGQPIQNTQ LYVLDQNQRL QSIGIEGELY IGGAGLARGY LNRPNLTAEK FVSHPFRLGE       840
     QLYRTGDSVR YLTDGNLEFI GRMDHQVKMR GFRIELGEIE ATLEKYSFIK EAVVLVREDR       900
     PGDQRLVAYV ISDGNTQKWR EYLQNQLPNH MIPAHLVELE QFPLTPNGKI DRKALPAPDE       960
     QPMGDFNVLP RTPTEELIAS VWSQVLGIEN IGIQDSFFEQ GGHSLLATQI VSRLQELFQI      1020
     KIPLRELFKH DTVESLAERV DQLRKEDKKR EVPPLVPMTR EESIPLSYAQ KRLWFIDQLM      1080
     PNNAMYNIHA ACRLTGKWSI EALEAGWNQL LERHESLRTI ILEQEGEPFQ QVQSHVFRHI      1140
     PQTDLTDLSL EDRKREMKRL IQNEAEETFH FGQGPLIRTR ILKVDREEWV LLCTMHHIIS      1200
     DGWSMGILLE EWMAFYEGAL SEKPPELKEL SIQYADFVMW QKEWQKEENL DQHLQYWKEE      1260
     LSGELPVLQL PMDRPRPAVQ THRGASQSLM VANSLQEKLK GLSLQEGSTL FMTLMAAYQS      1320
     FLSRYSGQDD ILVGSPIANR NVKEVEGLIG FFANTLVYRA DFSGNPTFQE LLSQIRKKAL      1380
     KAYEYQDIPF EEVVESVKPE RNTSHSPIFQ TMFTLQNTKQ EFPQLSERHM ELMESHTSVA      1440
     KFDLSLFASE TEEGLSLTFE YNTDLFNDTT IERMASHFEH WLYQIVSHPK DLLSELNMLS      1500
     KVEYKQLLEE WNETGVVDIR ESTIHTLFEE QVEKTPEAIA VVCEDEELTY RELDERSNQL      1560
     AHYLQKHGVG CESMVGICVT RSSEMIVGLL GIMKAGGAYV PIDPAYPESR LQYILEDAHI      1620
     KVLVTLEKLQ QKMVIPKSVA VICIDRDREE IEQEVTTVCT SEVTGDNLAY IIYTSGSTGN      1680
     PKGVMIEHRN TVTMIHWAHH TYSQKELAGV LASTSLSFDL SVFEVFVPLT MGGKVIVAEN      1740
     ALHLDKLSTK GVTLVNTVPS AAKELVRAKT IPSSVKVMNL AGEPLPYSLV QDLYERSTIE      1800
     KVYNLYGPSE DTTYSTYMEL EKGVMHRVPP IGKPVFNTEV YVLSAEQKMV PIGVVGELYI      1860
     GGSGLARGYL NRPDLTQDRF IPHPFKEGER VYRTGDLVRY LPDGNLEYLG RIDHQVKIRG      1920
     FRIELGEIEA TLQKHALVNE VLVMVREDYP GDPRLIAYVL GDGDAHKWRD YLKDQLPNYM      1980
     IPAYFVGLNA FPLTSNGKID RKALPAPERQ EIASGYIAPR TPTEKTIVSI WHQVLGVENI      2040
     GVQDSFFEIG GHSLLATQAV SNLKEAFGIE LPLHDLFTFH TVQQLAKQID QLFYNKNQEI      2100
     QNDSKENVSL QDYIQKEAEV SNDEELLELL KQLEELSEEE AQGIFESNLV EEGVKK          2156
//

If you have problems or comments...

PBIL Back to PBIL home page